DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and lrrcc1

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_690381.2 Gene:lrrcc1 / 561887 ZFINID:ZDB-GENE-041111-207 Length:997 Species:Danio rerio


Alignment Length:172 Identity:45/172 - (26%)
Similarity:76/172 - (44%) Gaps:35/172 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MDSTLGTLVQ------CERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEEL 98
            :|..:.:|::      ...:::..|.:.||.||:....::.|.||.|:|.:|.||.::: :|..|
Zfish     9 IDKDISSLLEVSLNPSISSLNLHCNRLTKIEGLTTAWHIRHLDLSSNHICRIEGLASLS-SLRTL 72

  Fly    99 WLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWS-----------------EFNRLAEIESLEDLV 146
            .||.|||.|::||.||..|..|.::.|.|.|.:                 ..|||..:..|...:
Zfish    73 NLSCNLITKVEGLDGLTNLTRLNLAYNQINDLTGLLYLHGANYKLKYLQLHSNRLDSMNHLLQCM 137

  Fly   147 VVGNPL------SEGLDEPT-----WRAECIKRLPTIRKLDG 177
            |....|      .:|.:.|.     :|...::.|..:..|||
Zfish   138 VGLQNLKYITLSKDGAENPVCKMIGYREMVLQCLHQVTTLDG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 45/172 (26%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
leucine-rich repeat 95..116 CDD:275380 12/20 (60%)
leucine-rich repeat 117..141 CDD:275380 8/40 (20%)
lrrcc1XP_690381.2 LRR_4 23..65 CDD:289563 13/41 (32%)
leucine-rich repeat 25..46 CDD:275378 5/20 (25%)
LRR_8 46..101 CDD:290566 23/55 (42%)
LRR_4 46..87 CDD:289563 18/41 (44%)
leucine-rich repeat 47..68 CDD:275378 8/21 (38%)
LRR_4 68..107 CDD:289563 17/38 (45%)
leucine-rich repeat 69..90 CDD:275378 12/20 (60%)
LRR_8 89..149 CDD:290566 11/59 (19%)
LRR_4 89..133 CDD:289563 8/43 (19%)
leucine-rich repeat 91..116 CDD:275378 5/24 (21%)
leucine-rich repeat 117..129 CDD:275378 3/11 (27%)
Rootletin 754..>869 CDD:291694
DUF342 <817..895 CDD:302792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.