DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and lrrc61

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001036219.1 Gene:lrrc61 / 553439 ZFINID:ZDB-GENE-060616-245 Length:260 Species:Danio rerio


Alignment Length:140 Identity:41/140 - (29%)
Similarity:67/140 - (47%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLE--AVAETLEELWLSYNLIE 106
            :|..:..||:.:|.|.|..:..||.::.|..|:||.|   :||.||  |..|:|:.|.::.|:|.
Zfish    48 IGECINLERLDLSGNNITNLGPLSPLRRLLSLNLSAN---RISNLEPLATCESLQSLNVAGNVIS 109

  Fly   107 KIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPT 171
            .:..|..||.|:                ||..|...::.....||:.:   .|::|...::..|.
Zfish   110 SVDNLHSLKSLR----------------RLENIRLKDNTYNFTNPVCK---NPSYRPLILEIFPN 155

  Fly   172 IRKLDGEPVV 181
            ::.||||.||
Zfish   156 MKVLDGERVV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 39/137 (28%)
leucine-rich repeat 50..71 CDD:275380 7/20 (35%)
leucine-rich repeat 95..116 CDD:275380 6/20 (30%)
leucine-rich repeat 117..141 CDD:275380 4/23 (17%)
lrrc61NP_001036219.1 leucine-rich repeat 54..81 CDD:275378 9/26 (35%)
leucine-rich repeat 98..122 CDD:275378 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.