DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and PPP1R7

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_002703.1 Gene:PPP1R7 / 5510 HGNCID:9295 Length:360 Species:Homo sapiens


Alignment Length:162 Identity:48/162 - (29%)
Similarity:82/162 - (50%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLS 101
            ||.:|    ||...|.:.:..|.|.|:..|..:..|.|||:..|.:.:|.||:.:. .|.||:||
Human   201 IENID----TLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLV-NLRELYLS 260

  Fly   102 YNLIEKIKGL----------------------TGLKCLKVLYISNNLIKDWSEFNRLAEIESLED 144
            :|.||.|:||                      :.|..|:..::::||::.||:.:.|....|||.
Human   261 HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLET 325

  Fly   145 LVVVGNPLSEGLDEPTWRAECIKRLPTIRKLD 176
            :.:..|||.:   :|.:|.:.:..||::|::|
Human   326 VYLERNPLQK---DPQYRRKVMLALPSVRQID 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 48/162 (30%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
leucine-rich repeat 95..116 CDD:275380 12/42 (29%)
leucine-rich repeat 117..141 CDD:275380 6/23 (26%)
PPP1R7NP_002703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
LRR 1 77..98
internalin_A 87..>317 CDD:380193 35/120 (29%)
LRR 2 99..120
leucine-rich repeat 100..121 CDD:275380
LRR 3 121..142
leucine-rich repeat 122..143 CDD:275380
LRR 4 143..164
leucine-rich repeat 144..165 CDD:275380
LRR 5 165..186
leucine-rich repeat 166..187 CDD:275380
LRR 6 187..208 4/10 (40%)
leucine-rich repeat 188..209 CDD:275380 5/11 (45%)
LRR 7 209..230 5/20 (25%)
leucine-rich repeat 210..231 CDD:275380 5/20 (25%)
LRR 8 231..252 8/20 (40%)
leucine-rich repeat 232..253 CDD:275380 8/21 (38%)
LRR 9 253..274 11/20 (55%)
leucine-rich repeat 254..275 CDD:275380 11/20 (55%)
LRR 10 275..296 0/20 (0%)
leucine-rich repeat 276..297 CDD:275380 1/20 (5%)
LRR 11 297..318 5/20 (25%)
LRRcap 336..354 CDD:197729 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.