| Sequence 1: | NP_610483.1 | Gene: | CG8800 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001185946.1 | Gene: | LRRC49 / 54839 | HGNCID: | 25965 | Length: | 691 | Species: | Homo sapiens |
| Alignment Length: | 217 | Identity: | 53/217 - (24%) |
|---|---|---|---|
| Similarity: | 95/217 - (43%) | Gaps: | 54/217 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 18 EQQNSLTAKVID-------LQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVL 75
Fly 76 SLSRNYIKQISGLEAV-------------------------------------------AETLEE 97
Fly 98 LWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWR 162
Fly 163 AECIKRLPTIRKLDGEPVVLNE 184 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8800 | NP_610483.1 | PPP1R42 | 37..180 | CDD:411060 | 46/185 (25%) |
| leucine-rich repeat | 50..71 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 95..116 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 117..141 | CDD:275380 | 7/23 (30%) | ||
| LRRC49 | NP_001185946.1 | LRR_8 | 118..173 | CDD:290566 | 18/55 (33%) |
| LRR_4 | 118..158 | CDD:289563 | 10/40 (25%) | ||
| LRR 1 | 118..139 | 4/21 (19%) | |||
| leucine-rich repeat | 119..140 | CDD:275380 | 5/21 (24%) | ||
| LRR_4 | 139..181 | CDD:289563 | 18/41 (44%) | ||
| LRR 2 | 140..161 | 7/20 (35%) | |||
| leucine-rich repeat | 141..162 | CDD:275380 | 7/20 (35%) | ||
| LRR 3 | 162..183 | 12/20 (60%) | |||
| LRR_4 | 163..203 | CDD:289563 | 11/39 (28%) | ||
| leucine-rich repeat | 163..184 | CDD:275380 | 11/20 (55%) | ||
| LRR 4 | 184..205 | 0/20 (0%) | |||
| leucine-rich repeat | 185..206 | CDD:275380 | 0/20 (0%) | ||
| LRR_4 | 205..247 | CDD:289563 | 6/41 (15%) | ||
| LRR_8 | 206..261 | CDD:290566 | 12/54 (22%) | ||
| LRR 5 | 206..227 | 0/20 (0%) | |||
| leucine-rich repeat | 207..228 | CDD:275380 | 0/20 (0%) | ||
| LRR_4 | 228..268 | CDD:289563 | 13/39 (33%) | ||
| LRR 6 | 228..249 | 6/20 (30%) | |||
| leucine-rich repeat | 229..250 | CDD:275380 | 7/20 (35%) | ||
| LRR 7 | 250..271 | 6/20 (30%) | |||
| leucine-rich repeat | 251..275 | CDD:275380 | 7/23 (30%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 365..393 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR15454 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||