DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8800 and Lrrc6

DIOPT Version :9

Sequence 1:	NP_610483.1	Gene:	CG8800 / 35962	FlyBaseID:	FBgn0033408	Length:	188	Species:	Drosophila melanogaster
Sequence 2:	NP_062330.1	Gene:	Lrrc6 / 54562	MGIID:	1859553	Length:	473	Species:	Mus musculus

Alignment Length:	138	Identity:	40/138 - (28%)
Similarity:	70/138 - (50%)	Gaps:	5/138 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    51 ERISMSTNMIEKIFGL-SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGL 114
            |.:|:....||::..: ...:.||:|.|..|.|.:|..:..: :.||.|.|:.|.||:|:.|.|.
Mouse    24 EELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIENVSKL-KKLEYLNLALNNIERIENLEGC 87

  Fly   115 KCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEP 179
            :.|..|.::.|.|.:.|....|.....|::|.::|||.:   |...:|...:..|..::.|||:.
Mouse    88 EWLTKLDLTVNFIGELSSVKTLTHNIHLKELFLMGNPCA---DFDGYRQFVVVTLQQLKWLDGKE 149

  Fly   180 VVLNEEPQ 187
            :..:|..|
Mouse   150 IERSERIQ 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8800	NP_610483.1	PPP1R42	37..180	CDD:411060	38/129 (29%)
		leucine-rich repeat	50..71	CDD:275380	4/20 (20%)
		leucine-rich repeat	95..116	CDD:275380	10/20 (50%)
		leucine-rich repeat	117..141	CDD:275380	6/23 (26%)
Lrrc6	NP_062330.1	LRR_4	22..64	CDD:289563	11/39 (28%)
		LRR 1	22..43		4/18 (22%)
		leucine-rich repeat	23..45	CDD:275378	4/20 (20%)
		LRR 2	45..66		7/21 (33%)
		LRR_8	46..98	CDD:290566	19/52 (37%)
		LRR_4	46..86	CDD:289563	16/40 (40%)
		leucine-rich repeat	46..67	CDD:275378	7/21 (33%)
		LRR 3	67..88		10/20 (50%)
		leucine-rich repeat	68..89	CDD:275378	10/20 (50%)
		LRR 4	89..110		5/20 (25%)
		leucine-rich repeat	90..114	CDD:275378	6/23 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	188..244
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	273..292
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	387..473
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900