DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and Lrriq3

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001019478.1 Gene:Lrriq3 / 499732 RGDID:1591943 Length:633 Species:Rattus norvegicus


Alignment Length:192 Identity:46/192 - (23%)
Similarity:74/192 - (38%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKATTIKEALKRWEE---REQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEK 62
            ::|..|..|....:.|   .:|::.:..|...|..:  .:|.:.|.:...| |   ..|.|.:..
  Rat     6 ITKELTSHEEWSHYNENIVEDQKDFVFVKYNGLHLK--SMENLQSCISLRV-C---IFSNNFVTD 64

  Fly    63 IFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEE--LWLSYNLIEKIKGLTGLKCLKVLYISNN 125
            |..|.|.|.|..|.|..|.||          ||.:  .|            .|||.||:||:.:|
  Rat    65 IQPLQGCKKLIKLDLHGNQIK----------TLPDRTFW------------NGLKNLKLLYLHDN 107

  Fly   126 LIKDWSEFNRLAEIESLEDLVVVGNPLS--EGLDEPTWRAECIKRLPTIRKLDGEPVVLNEE 185
            ..........|:...:|..|.:...|:|  :|     :|...:..:..::.|| ..|:.:||
  Rat   108 GFAKLKNICVLSGCVNLVGLTMFDCPVSLKKG-----YRHVLVNSIWPLKALD-HHVISDEE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 36/146 (25%)
leucine-rich repeat 50..71 CDD:275380 6/20 (30%)
leucine-rich repeat 95..116 CDD:275380 4/22 (18%)
leucine-rich repeat 117..141 CDD:275380 6/23 (26%)
Lrriq3NP_001019478.1 PPP1R42 36..>128 CDD:411060 30/119 (25%)
LRR 1 51..72 7/24 (29%)
leucine-rich repeat 52..73 CDD:275378 7/24 (29%)
LRR 2 73..94 9/42 (21%)
leucine-rich repeat 74..98 CDD:275378 11/45 (24%)
LRR 3 98..119 5/20 (25%)
leucine-rich repeat 99..115 CDD:275378 5/15 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..343
DUF5401 <388..>586 CDD:375164
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.