| Sequence 1: | NP_610483.1 | Gene: | CG8800 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001006054.1 | Gene: | lrrc23 / 450033 | ZFINID: | ZDB-GENE-041010-153 | Length: | 326 | Species: | Danio rerio |
| Alignment Length: | 210 | Identity: | 54/210 - (25%) |
|---|---|---|---|
| Similarity: | 90/210 - (42%) | Gaps: | 62/210 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 QFQWPPIEKMDSTL---------GTLVQCERISMSTNMIEKIFGLSGM----------------- 69
Fly 70 ----------------KCLKV-----------LSLSRNYIKQISGLEAVAETLEELWLSYNLIEK 107
Fly 108 IKGLT-GLKCLKVLYISNNLIKDWSEFNRLAEI-ESLEDLVVVGNPLSEGLDEPTWRAECIKRLP 170
Fly 171 TIRKLDGEPVVLNEE 185 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8800 | NP_610483.1 | PPP1R42 | 37..180 | CDD:411060 | 49/197 (25%) |
| leucine-rich repeat | 50..71 | CDD:275380 | 5/53 (9%) | ||
| leucine-rich repeat | 95..116 | CDD:275380 | 7/21 (33%) | ||
| leucine-rich repeat | 117..141 | CDD:275380 | 7/24 (29%) | ||
| lrrc23 | NP_001006054.1 | leucine-rich repeat | 64..83 | CDD:275380 | |
| LRR_4 | 65..102 | CDD:289563 | |||
| LRR_8 | 83..140 | CDD:290566 | 10/37 (27%) | ||
| leucine-rich repeat | 84..105 | CDD:275380 | 54/210 (26%) | ||
| leucine-rich repeat | 106..129 | CDD:275380 | 7/25 (28%) | ||
| leucine-rich repeat | 130..150 | CDD:275380 | 5/19 (26%) | ||
| LRR_8 | 149..206 | CDD:290566 | 5/56 (9%) | ||
| leucine-rich repeat | 151..174 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 175..195 | CDD:275380 | 2/19 (11%) | ||
| LRR_8 | 194..251 | CDD:290566 | 21/57 (37%) | ||
| LRR_4 | 194..235 | CDD:289563 | 15/41 (37%) | ||
| leucine-rich repeat | 196..217 | CDD:275380 | 8/21 (38%) | ||
| LRR_4 | 216..258 | CDD:289563 | 15/41 (37%) | ||
| leucine-rich repeat | 218..240 | CDD:275380 | 7/21 (33%) | ||
| leucine-rich repeat | 241..262 | CDD:275380 | 6/20 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||