| Sequence 1: | NP_610483.1 | Gene: | CG8800 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
| Alignment Length: | 198 | Identity: | 47/198 - (23%) |
|---|---|---|---|
| Similarity: | 97/198 - (48%) | Gaps: | 31/198 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFG 65
Fly 66 LSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIE-------------------KIKGL 111
Fly 112 TGLKCLKV---LYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIR 173
Fly 174 KLD 176 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8800 | NP_610483.1 | PPP1R42 | 37..180 | CDD:411060 | 42/162 (26%) |
| leucine-rich repeat | 50..71 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 95..116 | CDD:275380 | 9/39 (23%) | ||
| leucine-rich repeat | 117..141 | CDD:275380 | 6/26 (23%) | ||
| sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
| LRR_8 | 61..117 | CDD:290566 | |||
| leucine-rich repeat | 63..84 | CDD:275380 | |||
| LRR_4 | 83..125 | CDD:289563 | |||
| leucine-rich repeat | 85..106 | CDD:275380 | |||
| LRR_8 | 105..183 | CDD:290566 | 9/58 (16%) | ||
| leucine-rich repeat | 107..128 | CDD:275380 | |||
| LRR_4 | 128..168 | CDD:289563 | 6/43 (14%) | ||
| leucine-rich repeat | 129..150 | CDD:275380 | 2/20 (10%) | ||
| LRR_4 | 149..189 | CDD:289563 | 10/44 (23%) | ||
| leucine-rich repeat | 151..172 | CDD:275380 | 5/25 (20%) | ||
| leucine-rich repeat | 173..194 | CDD:275380 | 5/20 (25%) | ||
| LRR_8 | 194..249 | CDD:290566 | 16/55 (29%) | ||
| LRR_4 | 194..235 | CDD:289563 | 16/41 (39%) | ||
| leucine-rich repeat | 195..216 | CDD:275380 | 10/21 (48%) | ||
| leucine-rich repeat | 217..238 | CDD:275380 | 6/20 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||