DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ODA-Dnal1 and sds22

DIOPT Version :10

Sequence 1:NP_610483.1 Gene:ODA-Dnal1 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster


Alignment Length:198 Identity:47/198 - (23%)
Similarity:97/198 - (48%) Gaps:31/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFG 65
            :.|...:...:.:.|..:...:||.    |:.....::|::: :..||...::.:..|.|.||..
  Fly   129 LEKVYFVSNRITQIENLDMLTNLTM----LELGDNKLKKIEN-IEMLVNLRQLFLGKNKIAKIEN 188

  Fly    66 LSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIE-------------------KIKGL 111
            |..:..|::|||..|.|.:|..||.:| .|.||::|.|.:|                   ::||:
  Fly   189 LDTLVNLEILSLQANRIVKIENLEKLA-NLRELYVSENGVETIENLSENTKLETLDLAKNRLKGI 252

  Fly   112 TGLKCLKV---LYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIR 173
            ..|:.|::   |::::|.:.||.:...|...::|:.:.:..|||::   :..:|::....||.::
  Fly   253 ANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAK---DVRYRSKLRDILPQLQ 314

  Fly   174 KLD 176
            |:|
  Fly   315 KID 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ODA-Dnal1NP_610483.1 PPP1R42 37..180 CDD:455733 42/162 (26%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
leucine-rich repeat 95..116 CDD:275380 9/39 (23%)
leucine-rich repeat 117..141 CDD:275380 6/26 (23%)
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
PPP1R42 44..208 CDD:455733 19/83 (23%)
leucine-rich repeat 63..84 CDD:275380
leucine-rich repeat 85..106 CDD:275380
leucine-rich repeat 107..128 CDD:275380
leucine-rich repeat 129..150 CDD:275380 2/20 (10%)
PPP1R42 132..317 CDD:455733 45/193 (23%)
leucine-rich repeat 151..172 CDD:275380 5/25 (20%)
leucine-rich repeat 173..194 CDD:275380 5/20 (25%)
leucine-rich repeat 195..216 CDD:275380 10/21 (48%)
leucine-rich repeat 217..238 CDD:275380 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.