DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and CG14185

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster


Alignment Length:201 Identity:51/201 - (25%)
Similarity:86/201 - (42%) Gaps:48/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TIKEALKRWEER------EQQN----SLTAKVIDLQFQWPPIEKMD---STLGT-------LVQC 50
            |:.|.|:|..:|      ||..    |.|..:..|....|.::.:|   |.|.:       |:|.
  Fly   105 TLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLDLSGSVLSSLRDLGYGLLQL 169

  Fly    51 ERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLK 115
            .|:.:|...:....|.||:..::||               :|:.        |:|:::..|..|.
  Fly   170 TRLDISNCGLNSFDGTSGLPAIRVL---------------IADG--------NMIQRVDPLAELV 211

  Fly   116 CLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPV 180
            .|:||...||.|.:....:.|.....|:::.:.|||:..   .|.:|:...:.:||::.|||.  
  Fly   212 HLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCR---LPLYRSLLARSVPTLQLLDGR-- 271

  Fly   181 VLNEEP 186
            |||.||
  Fly   272 VLNGEP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 35/152 (23%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
leucine-rich repeat 95..116 CDD:275380 4/20 (20%)
leucine-rich repeat 117..141 CDD:275380 7/23 (30%)
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 15/79 (19%)
leucine-rich repeat 146..168 CDD:275380 4/21 (19%)
LRR_4 168..209 CDD:289563 12/63 (19%)
leucine-rich repeat 169..190 CDD:275380 5/20 (25%)
leucine-rich repeat 191..212 CDD:275380 7/43 (16%)
leucine-rich repeat 213..237 CDD:275380 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.