Sequence 1: | NP_610483.1 | Gene: | CG8800 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 51/201 - (25%) |
---|---|---|---|
Similarity: | 86/201 - (42%) | Gaps: | 48/201 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 TIKEALKRWEER------EQQN----SLTAKVIDLQFQWPPIEKMD---STLGT-------LVQC 50
Fly 51 ERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLK 115
Fly 116 CLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPV 180
Fly 181 VLNEEP 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8800 | NP_610483.1 | PPP1R42 | 37..180 | CDD:411060 | 35/152 (23%) |
leucine-rich repeat | 50..71 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 95..116 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 117..141 | CDD:275380 | 7/23 (30%) | ||
CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 15/79 (19%) |
leucine-rich repeat | 146..168 | CDD:275380 | 4/21 (19%) | ||
LRR_4 | 168..209 | CDD:289563 | 12/63 (19%) | ||
leucine-rich repeat | 169..190 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 191..212 | CDD:275380 | 7/43 (16%) | ||
leucine-rich repeat | 213..237 | CDD:275380 | 7/23 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |