| Sequence 1: | NP_610483.1 | Gene: | CG8800 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261433.1 | Gene: | CG13708 / 38582 | FlyBaseID: | FBgn0035577 | Length: | 1301 | Species: | Drosophila melanogaster |
| Alignment Length: | 230 | Identity: | 53/230 - (23%) |
|---|---|---|---|
| Similarity: | 88/230 - (38%) | Gaps: | 75/230 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 SKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGL 66
Fly 67 SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWL----------SYNLIEKIKGLT--------- 112
Fly 113 ------GLKCLKVLYISNNLIKDWSEFNRLAEIESL----------EDL------------VVVG 149
Fly 150 NPLSEGLDEPTWRAEC----IKRLPTIRKLDGEPV 180 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8800 | NP_610483.1 | PPP1R42 | 37..180 | CDD:411060 | 41/193 (21%) |
| leucine-rich repeat | 50..71 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 95..116 | CDD:275380 | 8/45 (18%) | ||
| leucine-rich repeat | 117..141 | CDD:275380 | 5/23 (22%) | ||
| CG13708 | NP_001261433.1 | LRR_RI | <428..572 | CDD:238064 | 39/147 (27%) |
| leucine-rich repeat | 449..471 | CDD:275380 | 7/37 (19%) | ||
| leucine-rich repeat | 472..493 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 475..527 | CDD:290566 | 19/51 (37%) | ||
| leucine-rich repeat | 494..516 | CDD:275380 | 9/21 (43%) | ||
| LRR_8 | 516..574 | CDD:290566 | 13/57 (23%) | ||
| leucine-rich repeat | 517..539 | CDD:275380 | 4/21 (19%) | ||
| leucine-rich repeat | 540..563 | CDD:275380 | 4/22 (18%) | ||
| LRR_4 | 564..604 | CDD:289563 | 8/39 (21%) | ||
| leucine-rich repeat | 564..585 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 611..637 | CDD:275380 | 5/32 (16%) | ||
| LRR_9 | <1059..1153 | CDD:258718 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||