DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and Lrrc43

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001028633.1 Gene:Lrrc43 / 381741 MGIID:2685907 Length:667 Species:Mus musculus


Alignment Length:169 Identity:47/169 - (27%)
Similarity:74/169 - (43%) Gaps:32/169 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGL-EAVAETLEELWL 100
            :..:|..|...::.|.:.:|.|.||:|...:....||||.|..|.|..:..| .|....|:.|.|
Mouse   136 VSLVDKDLLKFLKLEELVLSANKIEEIDANNLPPTLKVLELYGNLIASMECLCSAPPPRLQHLGL 200

  Fly   101 SYNLIEKIKGLTGLKCLKVLYISNNLIKDWSE-------FNRLAEIES----------LEDLVVV 148
            .:|.:        |..|:.||::::   :|.:       ||.|.::::          |..||:.
Mouse   201 GHNKL--------LGPLESLYVTSH---NWPQLVSLDLGFNNLTDLQNMILGLSTLRHLRLLVLQ 254

  Fly   149 GNPLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLNEEPQ 187
            |||||.   .|.:|...|..|..:..||...|..||:.|
Mouse   255 GNPLSL---VPYYRGFTIDSLAHLCVLDDITVSPNEKHQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 43/160 (27%)
leucine-rich repeat 50..71 CDD:275380 6/20 (30%)
leucine-rich repeat 95..116 CDD:275380 5/20 (25%)
leucine-rich repeat 117..141 CDD:275380 7/30 (23%)
Lrrc43NP_001028633.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
LRR 1 148..169 6/20 (30%)
LRR <154..>263 CDD:227223 34/122 (28%)
LRR 2 170..191 8/20 (40%)
leucine-rich repeat 171..194 CDD:275378 9/22 (41%)
LRR 3 194..213 6/26 (23%)
leucine-rich repeat 195..221 CDD:275378 9/36 (25%)
LRR 4 221..242 3/20 (15%)
leucine-rich repeat 222..247 CDD:275378 3/24 (13%)
leucine-rich repeat 248..259 CDD:275378 6/10 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 616..640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.