DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8800 and Lrrc56

DIOPT Version :9

Sequence 1:	NP_610483.1	Gene:	CG8800 / 35962	FlyBaseID:	FBgn0033408	Length:	188	Species:	Drosophila melanogaster
Sequence 2:	NP_001020073.1	Gene:	Lrrc56 / 365389	RGDID:	1311654	Length:	548	Species:	Rattus norvegicus

Alignment Length:	124	Identity:	35/124 - (28%)
Similarity:	58/124 - (46%)	Gaps:	10/124 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    72 LKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRL 136
            |:||.|:|..:..:.|:.:.. .|:||::|||.|..:..|..|:.|:||.:..|.::|..:...|
  Rat   118 LQVLWLARCGLTDLDGIGSFL-ALKELYVSYNNISDLSPLCLLEQLEVLDLEGNNVEDLGQMRYL 181

  Fly   137 AEIESLEDLVVVGN---------PLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLNEEP 186
            .....|..|.:.||         |.::...:..:|||..|.:|.:..||..|......|
  Rat   182 QLCPRLTTLTLEGNLVCLKPDPGPSNKAPQDYNYRAEVKKLIPQLHILDEVPTTCTNLP 240

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8800	NP_610483.1	PPP1R42	37..180	CDD:411060	33/116 (28%)
		leucine-rich repeat	50..71	CDD:275380
		leucine-rich repeat	95..116	CDD:275380	9/20 (45%)
		leucine-rich repeat	117..141	CDD:275380	6/23 (26%)
Lrrc56	NP_001020073.1	PPP1R42	91..233	CDD:411060	33/115 (29%)
		LRR 1	94..115
		leucine-rich repeat	95..117	CDD:275380
		LRR 2	117..138		6/19 (32%)
		leucine-rich repeat	118..139	CDD:275380	6/21 (29%)
		LRR 3	139..160		8/20 (40%)
		leucine-rich repeat	140..161	CDD:275380	9/20 (45%)
		LRR 4	161..182		5/20 (25%)
		leucine-rich repeat	162..186	CDD:275380	6/23 (26%)
		LRR 5	186..206		4/19 (21%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	405..433
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810