DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ODA-Dnal1 and LRRC9

DIOPT Version :10

Sequence 1:NP_610483.1 Gene:ODA-Dnal1 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001342201.1 Gene:LRRC9 / 341883 HGNCID:19848 Length:1494 Species:Homo sapiens


Alignment Length:173 Identity:50/173 - (28%)
Similarity:70/173 - (40%) Gaps:41/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PPIEKMDST----LGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLE------ 89
            |||  |.|.    ||....|..|.:..|.:..         ||.|.|..|.|.|:.||:      
Human  1198 PPI--MHSLEVLHLGYNGICNLIQLQLNRLRN---------LKFLFLQGNEISQVEGLDNLVVLQ 1251

  Fly    90 -----------------AVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLA 137
                             |...:|..|.|..|.:.::..|..|..|:.|::..|.|:|.:|..:|.
Human  1252 ELVVDHNRIRSFNDSAFAKPSSLLALHLEENRLRELGKLQSLVKLEKLFLGYNKIQDITELEKLD 1316

  Fly   138 EIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPV 180
            .|.:|.:|.|.|||:...:   ..|...|.|||.::.|||.||
Human  1317 VISTLRELTVYGNPICRKM---LHRHMLIFRLPNLQMLDGSPV 1356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ODA-Dnal1NP_610483.1 PPP1R42 37..180 CDD:455733 46/169 (27%)
leucine-rich repeat 50..71 CDD:275380 3/20 (15%)
leucine-rich repeat 95..116 CDD:275380 6/20 (30%)
leucine-rich repeat 117..141 CDD:275380 8/23 (35%)
LRRC9NP_001342201.1 leucine-rich repeat 37..51 CDD:275380
PPP1R42 55..236 CDD:455733
leucine-rich repeat 56..77 CDD:275380
leucine-rich repeat 78..99 CDD:275380
leucine-rich repeat 100..121 CDD:275380
leucine-rich repeat 122..143 CDD:275380
leucine-rich repeat 144..166 CDD:275380
leucine-rich repeat 192..223 CDD:275381
LRR 631..1016 CDD:443914
leucine-rich repeat 698..717 CDD:275380
leucine-rich repeat 718..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 762..788 CDD:275380
leucine-rich repeat 789..846 CDD:275380
leucine-rich repeat 847..910 CDD:275380
PPP1R42 878..1066 CDD:455733
leucine-rich repeat 911..932 CDD:275380
leucine-rich repeat 933..954 CDD:275380
leucine-rich repeat 955..978 CDD:275380
leucine-rich repeat 1026..1094 CDD:275380
PPP1R42 1116..1361 CDD:455733 50/173 (29%)
leucine-rich repeat 1141..1166 CDD:275380
leucine-rich repeat 1167..1203 CDD:275380 4/6 (67%)
leucine-rich repeat 1204..1227 CDD:275380 5/22 (23%)
leucine-rich repeat 1228..1249 CDD:275380 9/20 (45%)
leucine-rich repeat 1250..1273 CDD:275380 1/22 (5%)
leucine-rich repeat 1274..1295 CDD:275380 6/20 (30%)
leucine-rich repeat 1296..1320 CDD:275380 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.