DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and tilB

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster


Alignment Length:140 Identity:43/140 - (30%)
Similarity:72/140 - (51%) Gaps:11/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EKMDSTLGTLVQCERISMSTNMIEKIFGLSG-MKCLKVLSLSRNYIKQISGLEAVAETLEELWLS 101
            |::.|||      |.||:....||.|..:.. .:.||:|.|..|.|.::..|..: :.||.|.::
  Fly    17 ERLISTL------EEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKL-KRLEYLNVA 74

  Fly   102 YNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECI 166
            .|.||:::.|.|.:.|..|.::.|.|::.:....|....:|.:||::|||.   :|.|.:|...:
  Fly    75 INNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPC---VDYPHYRDYVV 136

  Fly   167 KRLPTIRKLD 176
            ..||.:..||
  Fly   137 ATLPQLNSLD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 43/140 (31%)
leucine-rich repeat 50..71 CDD:275380 6/21 (29%)
leucine-rich repeat 95..116 CDD:275380 8/20 (40%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
tilBNP_608460.1 LRR_9 1..174 CDD:258718 43/140 (31%)
leucine-rich repeat 23..45 CDD:275378 7/27 (26%)
LRR_4 46..86 CDD:289563 14/40 (35%)
leucine-rich repeat 46..67 CDD:275378 7/21 (33%)
leucine-rich repeat 68..89 CDD:275378 8/20 (40%)
leucine-rich repeat 90..114 CDD:275378 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.