DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8800 and Lrrc23

DIOPT Version :9

Sequence 1:	NP_610483.1	Gene:	CG8800 / 35962	FlyBaseID:	FBgn0033408	Length:	188	Species:	Drosophila melanogaster
Sequence 2:	NP_001381276.1	Gene:	Lrrc23 / 312707	RGDID:	1304779	Length:	345	Species:	Rattus norvegicus

Alignment Length:	133	Identity:	41/133 - (30%)
Similarity:	72/133 - (54%)	Gaps:	6/133 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 LVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGL 111
            |.....:.:..|.:|...|::..| ||.|.|::|.:|::.|||.:: .|..|.|..|.||.:.|.
  Rat   180 LTNLHTLELRANQLETTIGINLPK-LKNLYLAQNLLKKVEGLENLS-NLTTLHLRDNQIETLDGF 242

  Fly   112 T-GLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKL 175
            : .:|.|:.|.:.:|:|.|..|..:|.::..|..||::.||.:   ||..:|.|.:.::..:.:|
  Rat   243 SKEMKSLQYLNLRSNMISDLGELAKLRDLPKLRALVLLDNPCA---DETDYRQEALVQMAHLERL 304

  Fly   176 DGE 178
            |.|
  Rat   305 DKE 307

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8800	NP_610483.1	PPP1R42	37..180	CDD:411060	41/133 (31%)
		leucine-rich repeat	50..71	CDD:275380	3/20 (15%)
		leucine-rich repeat	95..116	CDD:275380	7/21 (33%)
		leucine-rich repeat	117..141	CDD:275380	7/23 (30%)
Lrrc23	NP_001381276.1	leucine-rich repeat	75..94	CDD:275380
		PPP1R42	80..306	CDD:411060	39/130 (30%)
		leucine-rich repeat	95..116	CDD:275380
		leucine-rich repeat	117..137	CDD:275380
		leucine-rich repeat	138..158	CDD:275380
		leucine-rich repeat	159..182	CDD:275380	1/1 (100%)
		leucine-rich repeat	183..203	CDD:275380	3/19 (16%)
		leucine-rich repeat	204..225	CDD:275380	9/21 (43%)
		leucine-rich repeat	226..248	CDD:275380	7/21 (33%)
		leucine-rich repeat	249..273	CDD:275380	7/23 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810