DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and Cep97

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001100566.1 Gene:Cep97 / 304007 RGDID:1307400 Length:845 Species:Rattus norvegicus


Alignment Length:188 Identity:43/188 - (22%)
Similarity:76/188 - (40%) Gaps:61/188 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LGTLVQCE---RISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAV-------------- 91
            |..|.:|:   ::|::.|.:.::.|::.:..|:||:|..|.|..:.||:.:              
  Rat    51 LENLEKCKQLIQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGCMEGLKDLVHLEWLNLAGNNLK 115

  Fly    92 -------AETLEELWLSYNLIEKIKGLTGLKCLKVL---------------YISNNL-------- 126
                   ...|:.|.||.|.|.:|..::.|..||.|               |:..||        
  Rat   116 TMEQINSCSALQHLDLSDNNIPQIGDVSKLTALKTLLLHGNIITSLRMAPAYLPRNLSILSLAEN 180

  Fly   127 -IKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLN 183
             |:|.:|.:.||.:..||.|.::.||             |:...|:|...|..|.:::
  Rat   181 EIRDLNEISFLASLSELEQLSIMNNP-------------CVMATPSIPGFDYRPYIVS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 42/183 (23%)
leucine-rich repeat 50..71 CDD:275380 4/23 (17%)
leucine-rich repeat 95..116 CDD:275380 8/20 (40%)
leucine-rich repeat 117..141 CDD:275380 11/47 (23%)
Cep97NP_001100566.1 leucine-rich repeat 17..37 CDD:275380
LRR_RI <21..126 CDD:238064 14/74 (19%)
leucine-rich repeat 38..59 CDD:275380 3/7 (43%)
leucine-rich repeat 60..81 CDD:275380 3/20 (15%)
LRR_8 80..136 CDD:290566 13/55 (24%)
LRR_4 80..122 CDD:289563 8/41 (20%)
leucine-rich repeat 82..103 CDD:275380 8/20 (40%)
LRR_4 103..143 CDD:289563 7/39 (18%)
leucine-rich repeat 104..125 CDD:275380 0/20 (0%)
LRR_9 107..255 CDD:258718 29/132 (22%)
leucine-rich repeat 126..149 CDD:275380 8/22 (36%)
leucine-rich repeat 150..171 CDD:275380 2/20 (10%)
leucine-rich repeat 172..196 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.