DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ODA-Dnal1 and Lrrc9

DIOPT Version :10

Sequence 1:NP_610483.1 Gene:ODA-Dnal1 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001178542.1 Gene:Lrrc9 / 299129 RGDID:1565716 Length:1155 Species:Rattus norvegicus


Alignment Length:184 Identity:57/184 - (30%)
Similarity:88/184 - (47%) Gaps:40/184 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQI 85
            :|||....|:        |..|.|.|.::.:.:.::...||||.||.|.:.|:.|.|..|.|.:|
  Rat    57 SSLTIVAQDI--------KEISGLETCLRLKELWIAECCIEKIEGLHGCRNLEKLYLYYNKISKI 113

  Fly    86 SGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNR-LAEIESLEDLVVVG 149
            ..||.:.: ||.|||::|.|..|:||..||.||.|.::.|||   |...| |...|.||.|.:.|
  Rat   114 ENLEKLIK-LEVLWLNHNTIRNIEGLQTLKNLKDLNLAGNLI---SSIGRCLDPNEQLEKLNLSG 174

  Fly   150 NPLSE----------------GLDEPTWRAE-----C------IKRLPTIRKLD 176
            |.::.                .|::|.:::.     |      :..||::::||
  Rat   175 NQITSFKDLTNLTKLPRLKDLSLNDPQYKSNPVCQLCNYSTHVLYHLPSLQRLD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ODA-Dnal1NP_610483.1 PPP1R42 37..180 CDD:455733 53/168 (32%)
leucine-rich repeat 50..71 CDD:275380 7/20 (35%)
leucine-rich repeat 95..116 CDD:275380 11/20 (55%)
leucine-rich repeat 117..141 CDD:275380 9/24 (38%)
Lrrc9NP_001178542.1 leucine-rich repeat 47..77 CDD:275380 8/27 (30%)
leucine-rich repeat 78..99 CDD:275380 7/20 (35%)
PPP1R42 85..236 CDD:455733 49/148 (33%)
leucine-rich repeat 100..121 CDD:275380 8/20 (40%)
leucine-rich repeat 122..143 CDD:275380 11/20 (55%)
leucine-rich repeat 144..166 CDD:275380 9/24 (38%)
leucine-rich repeat 167..191 CDD:275380 5/23 (22%)
leucine-rich repeat 192..223 CDD:275380 4/30 (13%)
LRR 600..1042 CDD:443914
leucine-rich repeat 689..708 CDD:275380
leucine-rich repeat 709..730 CDD:275380
leucine-rich repeat 731..752 CDD:275380
leucine-rich repeat 753..779 CDD:275380
leucine-rich repeat 780..806 CDD:275380
leucine-rich repeat 807..865 CDD:275380
leucine-rich repeat 866..901 CDD:275380
PPP1R42 879..1057 CDD:455733
leucine-rich repeat 902..923 CDD:275380
leucine-rich repeat 924..945 CDD:275380
leucine-rich repeat 946..969 CDD:275380
leucine-rich repeat 992..1016 CDD:275380
leucine-rich repeat 1017..1044 CDD:275380
leucine-rich repeat 1045..1085 CDD:275380
leucine-rich repeat 1086..1112 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.