DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and LRRC43

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_016874613.1 Gene:LRRC43 / 254050 HGNCID:28562 Length:664 Species:Homo sapiens


Alignment Length:181 Identity:48/181 - (26%)
Similarity:77/181 - (42%) Gaps:43/181 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEA 90
            :|||.:     :..:|..|...::.|.:.:|.|.|:::...:....||||.|   |..:||.:|.
Human   140 RVIDKK-----VTLVDKDLLKFLKLEELVLSANRIKEVDATNLPPTLKVLEL---YGNEISSMEC 196

  Fly    91 VA----ETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSE-------FNRLAEIES--- 141
            :.    ..|:.|.|.:|.:        |..|:.||::.|   .|..       ||.|.:::|   
Human   197 LCAHPPAGLQHLGLGHNKL--------LGPLESLYVTAN---HWPNLVSLDLGFNDLTDLQSMVT 250

  Fly   142 -------LEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLNEE 185
                   |..||:.||||:.   .|.:|...|..|..:..||...|..||:
Human   251 SLRTLRHLRLLVLQGNPLAL---VPYYRGLTIDSLAQLCVLDDITVSPNEK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 42/163 (26%)
leucine-rich repeat 50..71 CDD:275380 4/20 (20%)
leucine-rich repeat 95..116 CDD:275380 5/20 (25%)
leucine-rich repeat 117..141 CDD:275380 8/30 (27%)
LRRC43XP_016874613.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.