DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and T05H4.3

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001343670.1 Gene:T05H4.3 / 188149 WormBaseID:WBGene00020266 Length:1150 Species:Caenorhabditis elegans


Alignment Length:187 Identity:46/187 - (24%)
Similarity:80/187 - (42%) Gaps:34/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVIDLQFQWPPIEKMDSTL------GTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQ 84
            :|.||..:...:|..|..|      ..||..:.:|:..|.:..:..|:.:.|||:|..|.|:|.:
 Worm   621 EVSDLMTRLTALELCDQKLTKLTGIQELVSLQFLSVRKNKLTSLKKLNRLPCLKLLDASFNHISK 685

  Fly    85 ISGL--------------------EAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKD 129
            |..|                    :::..| ..|.|..|.|:.:||:.....|:..::::||:||
 Worm   686 IEQLPSSLLHVDLSHNKLQTLVFCQSLGNT-RHLLLHRNQIKSMKGVESCVQLETFFVNDNLLKD 749

  Fly   130 WSEFNRLAEIESLEDLVVVGNPLS--EGLDEPTWRAECIKRLPTIRKLDGEPVVLNE 184
            .|:...|..:..|..|.:..|.||  ||     :|...::....:..||.:.:.|.|
 Worm   750 KSDVELLKTMPKLTHLDMSNNILSSAEG-----YRPRVMQAAQFLISLDRQIIPLEE 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 41/170 (24%)
leucine-rich repeat 50..71 CDD:275380 3/20 (15%)
leucine-rich repeat 95..116 CDD:275380 6/20 (30%)
leucine-rich repeat 117..141 CDD:275380 7/23 (30%)
T05H4.3NP_001343670.1 leucine-rich repeat 69..91 CDD:275380
leucine-rich repeat 92..113 CDD:275380
leucine-rich repeat 114..135 CDD:275380
leucine-rich repeat 136..157 CDD:275380
leucine-rich repeat 158..181 CDD:275380
leucine-rich repeat 182..206 CDD:275380
leucine-rich repeat 629..650 CDD:275380 4/20 (20%)
PLN00113 645..>1005 CDD:331614 40/163 (25%)
leucine-rich repeat 651..672 CDD:275380 3/20 (15%)
leucine-rich repeat 673..692 CDD:275380 8/18 (44%)
leucine-rich repeat 693..714 CDD:275380 0/20 (0%)
leucine-rich repeat 715..761 CDD:275380 14/46 (30%)
leucine-rich repeat 762..815 CDD:275380 12/45 (27%)
leucine-rich repeat 816..851 CDD:275380
leucine-rich repeat 855..875 CDD:275380
leucine-rich repeat 876..903 CDD:275380
leucine-rich repeat 904..952 CDD:275380
leucine-rich repeat 953..973 CDD:275380
leucine-rich repeat 974..994 CDD:275380
leucine-rich repeat 995..1019 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.