DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and sds-22

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_495653.1 Gene:sds-22 / 174266 WormBaseID:WBGene00011637 Length:326 Species:Caenorhabditis elegans


Alignment Length:188 Identity:54/188 - (28%)
Similarity:92/188 - (48%) Gaps:20/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKATTIKEALKRWEEREQQNSLT-AKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIF 64
            ::|..|:.....:.|:.|...:|| .|:::|...  .|:|::: :|.||..:.:.:..|.|.::.
 Worm   124 LTKLETLYLVSNKIEKIENLEALTQLKLLELGDN--RIKKIEN-IGHLVNLDELFIGKNKIRQLE 185

  Fly    65 GLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKD 129
            |:..::.|.||||..|.|.:|..:|.: ..|:||:||...::.|.|:..|..|.:|.::||.||.
 Worm   186 GVETLQKLSVLSLPGNRIVKIENVEQL-NNLKELYLSDQGLQDIHGVEPLTNLLLLDVANNEIKT 249

  Fly   130 WSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDG-EPVVLNEEP 186
            :|...||   |||.|.....|           :.|....:..:.||.| :.|.|...|
 Worm   250 FSGVERL---ESLNDFWANDN-----------KVESFSEIEQLSKLKGLQTVYLERNP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 43/143 (30%)
leucine-rich repeat 50..71 CDD:275380 3/20 (15%)
leucine-rich repeat 95..116 CDD:275380 8/20 (40%)
leucine-rich repeat 117..141 CDD:275380 9/23 (39%)
sds-22NP_495653.1 leucine-rich repeat 40..59 CDD:275380
leucine-rich repeat 60..82 CDD:275380
LRR_8 82..137 CDD:290566 2/12 (17%)
LRR_4 83..123 CDD:289563
leucine-rich repeat 83..104 CDD:275380
LRR_4 104..144 CDD:289563 4/19 (21%)
leucine-rich repeat 105..126 CDD:275380 0/1 (0%)
LRR_8 125..181 CDD:290566 14/58 (24%)
LRR_4 125..167 CDD:289563 10/44 (23%)
leucine-rich repeat 127..148 CDD:275380 4/20 (20%)
leucine-rich repeat 149..170 CDD:275380 6/23 (26%)
leucine-rich repeat 171..192 CDD:275380 3/20 (15%)
leucine-rich repeat 193..214 CDD:275380 9/21 (43%)
leucine-rich repeat 215..236 CDD:275380 8/20 (40%)
leucine-rich repeat 256..283 CDD:275380 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.