DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and C06A8.6

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_495634.1 Gene:C06A8.6 / 174253 WormBaseID:WBGene00015516 Length:349 Species:Caenorhabditis elegans


Alignment Length:199 Identity:54/199 - (27%)
Similarity:87/199 - (43%) Gaps:40/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKATTIK--EALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIF 64
            :|.|.|:  :.|...|..|..::..||          ||.:|:.|    :.:|:.:..|.|..|.
 Worm   130 NKITKIEGLDTLTELEYLELGDNRIAK----------IENLDNNL----KLDRLFLGANQIRLIE 180

  Fly    65 GLSGMKCLKVLSLSRN---YIKQISGLEAVAE------------------TLEELWLSYNLIEKI 108
            .:..:|.|.||||..|   .:..||||..:.|                  .||.|..:.|.:||:
 Worm   181 NVDHLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGIKYVCGIDEHLPLEILDFNQNRLEKV 245

  Fly   109 KGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIR 173
            :.:..||.|...:...|.:.:||..:.|.|:..|..:.:..||:: .:|  |:|.:.|..|..|.
 Worm   246 ENIHQLKTLTDFWARGNKLDNWSIMDELVELPQLNSVYLDFNPIA-SVD--TYRGKVIHLLQQIT 307

  Fly   174 KLDG 177
            :|||
 Worm   308 RLDG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 46/162 (28%)
leucine-rich repeat 50..71 CDD:275380 4/20 (20%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 6/23 (26%)
C06A8.6NP_495634.1 internalin_A 2..>279 CDD:380193 42/162 (26%)
leucine-rich repeat 35..55 CDD:275380
leucine-rich repeat 56..77 CDD:275380
leucine-rich repeat 78..99 CDD:275380
leucine-rich repeat 100..121 CDD:275380
leucine-rich repeat 122..143 CDD:275380 4/12 (33%)
leucine-rich repeat 144..165 CDD:275380 8/34 (24%)
leucine-rich repeat 166..187 CDD:275380 4/20 (20%)
leucine-rich repeat 188..209 CDD:275380 10/20 (50%)
leucine-rich repeat 210..230 CDD:275380 1/19 (5%)
leucine-rich repeat 232..278 CDD:275380 14/45 (31%)
LRRcap 293..310 CDD:197729 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.