Sequence 1: | NP_610483.1 | Gene: | CG8800 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495634.1 | Gene: | C06A8.6 / 174253 | WormBaseID: | WBGene00015516 | Length: | 349 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 54/199 - (27%) |
---|---|---|---|
Similarity: | 87/199 - (43%) | Gaps: | 40/199 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SKATTIK--EALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIF 64
Fly 65 GLSGMKCLKVLSLSRN---YIKQISGLEAVAE------------------TLEELWLSYNLIEKI 108
Fly 109 KGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIR 173
Fly 174 KLDG 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8800 | NP_610483.1 | PPP1R42 | 37..180 | CDD:411060 | 46/162 (28%) |
leucine-rich repeat | 50..71 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 95..116 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 117..141 | CDD:275380 | 6/23 (26%) | ||
C06A8.6 | NP_495634.1 | internalin_A | 2..>279 | CDD:380193 | 42/162 (26%) |
leucine-rich repeat | 35..55 | CDD:275380 | |||
leucine-rich repeat | 56..77 | CDD:275380 | |||
leucine-rich repeat | 78..99 | CDD:275380 | |||
leucine-rich repeat | 100..121 | CDD:275380 | |||
leucine-rich repeat | 122..143 | CDD:275380 | 4/12 (33%) | ||
leucine-rich repeat | 144..165 | CDD:275380 | 8/34 (24%) | ||
leucine-rich repeat | 166..187 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 188..209 | CDD:275380 | 10/20 (50%) | ||
leucine-rich repeat | 210..230 | CDD:275380 | 1/19 (5%) | ||
leucine-rich repeat | 232..278 | CDD:275380 | 14/45 (31%) | ||
LRRcap | 293..310 | CDD:197729 | 6/18 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |