DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and LRRIQ3

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001099129.1 Gene:LRRIQ3 / 127255 HGNCID:28318 Length:624 Species:Homo sapiens


Alignment Length:192 Identity:44/192 - (22%)
Similarity:73/192 - (38%) Gaps:45/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TIKEALKRWEE--------REQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEK 62
            |:.|.|...||        ||.|...    :.::|....::.|:: |.:.:.......|.|.|..
Human     5 TVTEELTSHEEWSHYNENIREGQKDF----VFVKFNGLHLKSMEN-LQSCISLRVCIFSNNFITD 64

  Fly    63 IFGLSGMKCLKV--LSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNN 125
            |..|  ..|:|:  |.|..|.||.:..        .:.|            .|||.||:||:.:|
Human    65 IHPL--QSCIKLIKLDLHGNQIKSLPN--------TKFW------------NGLKNLKLLYLHDN 107

  Fly   126 LIKDWSEFNRLAEIESLEDLVVVGNPLS--EGLDEPTWRAECIKRLPTIRKLDGEPVVLNEE 185
            ..........|:...:|..|.:...|:|  :|     :|...:..:..::.|| ..|:.:||
Human   108 GFAKLKNICVLSACPTLIALTMFDCPVSLKKG-----YRHVLVNSIWPLKALD-HHVISDEE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 32/146 (22%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
leucine-rich repeat 95..116 CDD:275380 3/20 (15%)
leucine-rich repeat 117..141 CDD:275380 6/23 (26%)
LRRIQ3NP_001099129.1 LRR_8 51..109 CDD:290566 21/79 (27%)
LRR_4 51..89 CDD:289563 12/39 (31%)
LRR 1 51..72 5/22 (23%)
leucine-rich repeat 52..73 CDD:275378 6/22 (27%)
LRR_4 73..115 CDD:289563 15/61 (25%)
LRR 2 73..94 7/40 (18%)
leucine-rich repeat 74..98 CDD:275378 8/43 (19%)
LRR 3 98..119 5/20 (25%)
leucine-rich repeat 99..123 CDD:275378 6/23 (26%)
leucine-rich repeat 124..135 CDD:275378 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.