DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and DNAAF1

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_011521155.1 Gene:DNAAF1 / 123872 HGNCID:30539 Length:772 Species:Homo sapiens


Alignment Length:175 Identity:54/175 - (30%)
Similarity:89/175 - (50%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RWEEREQQNSLTAKVIDLQFQWPPIEKMDS-TLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLS 76
            |.|..|:...|..    |..|...|:|::: ...|.::|  :.:..|::.||..|..::.|..|:
Human   121 RIENLEEYTGLRC----LWLQSNGIQKIENLEAQTELRC--LFLQMNLLRKIENLEPLQKLDALN 179

  Fly    77 LSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGL-KCLK--VLYISNNLIKDWSEFNRLAE 138
            ||.||||.|..|..: ..|..|.:::|.:|.::.:..| :||:  ||.:|:|.:.| .|.  |:.
Human   180 LSNNYIKTIENLSCL-PVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNKLSD-PEI--LSI 240

  Fly   139 IESLEDLVV---VGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPV 180
            :||:.||.|   :|||:...:  |.:|.....||..:..||..||
Human   241 LESMPDLRVLNLMGNPVIRQI--PNYRRTVTVRLKHLTYLDDRPV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 46/149 (31%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
leucine-rich repeat 95..116 CDD:275380 5/21 (24%)
leucine-rich repeat 117..141 CDD:275380 8/25 (32%)
DNAAF1XP_011521155.1 leucine-rich repeat 111..130 CDD:275380 3/8 (38%)
LRR_4 129..171 CDD:289563 11/47 (23%)
LRR_8 151..207 CDD:290566 19/58 (33%)
LRR_4 151..192 CDD:289563 15/42 (36%)
leucine-rich repeat 153..174 CDD:275380 5/22 (23%)
LRR_4 173..215 CDD:289563 14/42 (33%)
leucine-rich repeat 175..196 CDD:275380 10/21 (48%)
LRR_8 195..257 CDD:290566 21/64 (33%)
leucine-rich repeat 197..221 CDD:275380 6/23 (26%)
LRR_4 221..263 CDD:289563 15/46 (33%)
leucine-rich repeat 222..243 CDD:275380 7/23 (30%)
leucine-rich repeat 247..274 CDD:275380 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.