DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and CNTRL

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_011516468.1 Gene:CNTRL / 11064 HGNCID:1858 Length:2340 Species:Homo sapiens


Alignment Length:191 Identity:56/191 - (29%)
Similarity:98/191 - (51%) Gaps:21/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKEALKRWEEREQQNSLTAKVIDL--------QFQWPPIEKMDSTLGTLVQCERISMSTNMIEKI 63
            |.|||.: :..:|.|....|.::|        :|::  ||.::.    .|:.|.:::|.|:|.||
Human    83 ITEALIK-KLTKQDNLALIKSLNLSLSKDGGKKFKY--IENLEK----CVKLEVLNLSYNLIGKI 140

  Fly    64 FGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTG--LKCLKVLYISNNL 126
            ..|..:..|:.|:||.|.|.:|.|:|.:. .|::|.|:.|.||.|....|  ||.|:||.:..|.
Human   141 EKLDKLLKLRELNLSYNKISKIEGIENMC-NLQKLNLAGNEIEHIPVWLGKKLKSLRVLNLKGNK 204

  Fly   127 IKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLNEEPQ 187
            |....:.::|..::.|..|::|.||:   :..|.:....|..|.::..|:|:||...:..:
Human   205 ISSLQDISKLKPLQDLISLILVENPV---VTLPHYLQFTIFHLRSLESLEGQPVTTQDRQE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 45/144 (31%)
leucine-rich repeat 50..71 CDD:275380 7/20 (35%)
leucine-rich repeat 95..116 CDD:275380 9/22 (41%)
leucine-rich repeat 117..141 CDD:275380 6/23 (26%)
CNTRLXP_011516468.1 leucine-rich repeat 100..119 CDD:275378 3/20 (15%)
LRR_4 126..167 CDD:289563 15/40 (38%)
leucine-rich repeat 127..148 CDD:275380 7/20 (35%)
LRR_8 148..205 CDD:290566 23/57 (40%)
leucine-rich repeat 149..170 CDD:275380 9/21 (43%)
LRR_4 169..213 CDD:289563 15/44 (34%)
leucine-rich repeat 171..194 CDD:275380 9/22 (41%)
leucine-rich repeat 195..219 CDD:275380 6/23 (26%)
leucine-rich repeat 220..246 CDD:275380 8/28 (29%)
SMC_prok_B <435..1119 CDD:274008
DUF342 <513..610 CDD:302792
Pro-rich <1176..1299 CDD:291893
COG4372 1320..>1602 CDD:226809
Mplasa_alph_rch 1525..2221 CDD:275316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.