DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and Dnal1

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_083097.2 Gene:Dnal1 / 105000 MGIID:1921462 Length:190 Species:Mus musculus


Alignment Length:188 Identity:112/188 - (59%)
Similarity:141/188 - (75%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFG 65
            |:|||||||||.||||:..|....||.|.|..|.|||||||::|.||..||::|:|||.||||..
Mouse     1 MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIAN 65

  Fly    66 LSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDW 130
            |:|:|.|::|||.||.||.::|||||.|||||||:|||.|||:||:..:|.||:||:||||:|||
Mouse    66 LNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDW 130

  Fly   131 SEFNRLAEIESLEDLVVVGNPLSEGLD-EPTWRAECIKRLPTIRKLDGEPVVLNEEPQ 187
            :||.:|||:..|||||.|||||.|... |..|..|..||:|.::||||.||:..:|.:
Mouse   131 AEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEEE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 87/143 (61%)
leucine-rich repeat 50..71 CDD:275380 12/20 (60%)
leucine-rich repeat 95..116 CDD:275380 13/20 (65%)
leucine-rich repeat 117..141 CDD:275380 16/23 (70%)
Dnal1NP_083097.2 LRR_4 49..89 CDD:289563 22/39 (56%)
LRR 1 49..70 12/20 (60%)
leucine-rich repeat 50..71 CDD:275378 12/20 (60%)
LRR_8 70..127 CDD:290566 37/56 (66%)
LRR 2 71..92 12/20 (60%)
leucine-rich repeat 72..90 CDD:275378 10/17 (59%)
LRR 3 94..115 14/20 (70%)
LRR_4 95..133 CDD:289563 25/37 (68%)
leucine-rich repeat 95..116 CDD:275382 13/20 (65%)
LRR 4 116..137 13/20 (65%)
leucine-rich repeat 117..140 CDD:275382 16/22 (73%)
leucine-rich repeat 142..172 CDD:275382 16/29 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836612
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34623
Inparanoid 1 1.050 221 1.000 Inparanoid score I3540
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56366
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006128
OrthoInspector 1 1.000 - - otm43105
orthoMCL 1 0.900 - - OOG6_103843
Panther 1 1.100 - - O PTHR15454
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4855
SonicParanoid 1 1.000 - - X5866
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.