DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and Lrrc49

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_663591.3 Gene:Lrrc49 / 102747 MGIID:2442689 Length:752 Species:Mus musculus


Alignment Length:217 Identity:55/217 - (25%)
Similarity:94/217 - (43%) Gaps:54/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EQQNSLTAKVID-------LQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVL 75
            |:|......:||       |.||...|.::.: :..|.:...:.:..|.||:|.|||.:|.|:||
Mouse   164 ERQKLTVCPIIDGEEHLRLLNFQHNFITRIQN-ISNLQRLIFLDLYDNQIEEISGLSTLKSLRVL 227

  Fly    76 SLSRNYIKQISGLEAV-------------------------------------------AETLEE 97
            .|.:|.||:||.||.:                                           .::|.|
Mouse   228 LLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTE 292

  Fly    98 LWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWR 162
            |.|.:|.|..::.:..|.||:.|::|.|.|..:...:.|||..||.|:...|||:::   |..::
Mouse   293 LNLRHNQITFVRDVDNLPCLQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQ---ESWYK 354

  Fly   163 AECIKRLPTIRKLDGEPVVLNE 184
            ...::.:..:|:||.:.:...|
Mouse   355 HTVLQNMMQLRQLDMKRITEEE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 47/185 (25%)
leucine-rich repeat 50..71 CDD:275380 7/20 (35%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 8/23 (35%)
Lrrc49NP_663591.3 leucine-rich repeat 160..177 CDD:275380 4/12 (33%)
LRR_4 178..219 CDD:289563 10/41 (24%)
leucine-rich repeat 180..201 CDD:275380 5/21 (24%)
LRR_4 200..242 CDD:289563 18/41 (44%)
leucine-rich repeat 202..223 CDD:275380 7/20 (35%)
LRR_8 222..278 CDD:290566 12/55 (22%)
LRR_4 222..264 CDD:289563 12/41 (29%)
leucine-rich repeat 224..245 CDD:275380 11/20 (55%)
LRR_4 244..286 CDD:289563 0/41 (0%)
leucine-rich repeat 246..267 CDD:275380 0/20 (0%)
LRR_8 268..322 CDD:290566 12/53 (23%)
leucine-rich repeat 268..289 CDD:275380 0/20 (0%)
LRR_4 289..329 CDD:289563 13/39 (33%)
leucine-rich repeat 290..311 CDD:275380 7/20 (35%)
leucine-rich repeat 312..336 CDD:275380 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.