Sequence 1: | NP_610483.1 | Gene: | CG8800 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663591.3 | Gene: | Lrrc49 / 102747 | MGIID: | 2442689 | Length: | 752 | Species: | Mus musculus |
Alignment Length: | 217 | Identity: | 55/217 - (25%) |
---|---|---|---|
Similarity: | 94/217 - (43%) | Gaps: | 54/217 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 EQQNSLTAKVID-------LQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVL 75
Fly 76 SLSRNYIKQISGLEAV-------------------------------------------AETLEE 97
Fly 98 LWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWR 162
Fly 163 AECIKRLPTIRKLDGEPVVLNE 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8800 | NP_610483.1 | PPP1R42 | 37..180 | CDD:411060 | 47/185 (25%) |
leucine-rich repeat | 50..71 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 95..116 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 117..141 | CDD:275380 | 8/23 (35%) | ||
Lrrc49 | NP_663591.3 | leucine-rich repeat | 160..177 | CDD:275380 | 4/12 (33%) |
LRR_4 | 178..219 | CDD:289563 | 10/41 (24%) | ||
leucine-rich repeat | 180..201 | CDD:275380 | 5/21 (24%) | ||
LRR_4 | 200..242 | CDD:289563 | 18/41 (44%) | ||
leucine-rich repeat | 202..223 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 222..278 | CDD:290566 | 12/55 (22%) | ||
LRR_4 | 222..264 | CDD:289563 | 12/41 (29%) | ||
leucine-rich repeat | 224..245 | CDD:275380 | 11/20 (55%) | ||
LRR_4 | 244..286 | CDD:289563 | 0/41 (0%) | ||
leucine-rich repeat | 246..267 | CDD:275380 | 0/20 (0%) | ||
LRR_8 | 268..322 | CDD:290566 | 12/53 (23%) | ||
leucine-rich repeat | 268..289 | CDD:275380 | 0/20 (0%) | ||
LRR_4 | 289..329 | CDD:289563 | 13/39 (33%) | ||
leucine-rich repeat | 290..311 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 312..336 | CDD:275380 | 8/23 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR15454 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |