DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8800 and LRRC23

DIOPT Version :9

Sequence 1:	NP_610483.1	Gene:	CG8800 / 35962	FlyBaseID:	FBgn0033408	Length:	188	Species:	Drosophila melanogaster
Sequence 2:	NP_001128689.1	Gene:	LRRC23 / 10233	HGNCID:	19138	Length:	343	Species:	Homo sapiens

Alignment Length:	133	Identity:	39/133 - (29%)
Similarity:	74/133 - (55%)	Gaps:	6/133 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 LVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGL 111
            |:....:.:..|.:|...|::..| ||.|.|::|.:|::.|||.:: .|..|.|..|.|:.:.|.
Human   178 LISLHTVELRGNQLESTLGINLPK-LKNLYLAQNMLKKVEGLEDLS-NLTTLHLRDNQIDTLSGF 240

  Fly   112 T-GLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKL 175
            : .:|.|:.|.:..|::.:..|..:|.::..|..||::.||.:   ||.::|.|.:.::|.:.:|
Human   241 SREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCT---DETSYRQEALVQMPYLERL 302

  Fly   176 DGE 178
            |.|
Human   303 DKE 305

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8800	NP_610483.1	PPP1R42	37..180	CDD:411060	39/133 (29%)
		leucine-rich repeat	50..71	CDD:275380	3/20 (15%)
		leucine-rich repeat	95..116	CDD:275380	6/21 (29%)
		leucine-rich repeat	117..141	CDD:275380	5/23 (22%)
LRRC23	NP_001128689.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..47
		LRR 1	92..113
		leucine-rich repeat	93..114	CDD:275380
		LRR 2	114..134
		leucine-rich repeat	115..135	CDD:275380
		LRR 3	135..155
		leucine-rich repeat	136..156	CDD:275380
		LRR 4	156..177
		leucine-rich repeat	157..180	CDD:275380	1/1 (100%)
		LRR 5	180..200		3/19 (16%)
		leucine-rich repeat	181..201	CDD:275380	3/19 (16%)
		LRR_8	200..255	CDD:290566	19/56 (34%)
		LRR_4	200..241	CDD:289563	16/42 (38%)
		LRR 6	201..222		10/21 (48%)
		leucine-rich repeat	202..223	CDD:275380	9/21 (43%)
		LRR_4	223..265	CDD:289563	11/41 (27%)
		LRR 7	223..244		6/20 (30%)
		leucine-rich repeat	224..246	CDD:275380	6/21 (29%)
		LRR 8	246..267		4/20 (20%)
		leucine-rich repeat	247..271	CDD:275380	5/23 (22%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	318..343
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810