DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and lrrc56

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_012817843.1 Gene:lrrc56 / 100496856 XenbaseID:XB-GENE-6045468 Length:622 Species:Xenopus tropicalis


Alignment Length:149 Identity:40/149 - (26%)
Similarity:80/149 - (53%) Gaps:10/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DSTLGT-LVQCERISMSTNMIEKIFGL-SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYN 103
            |.:||: |....::.::.:::..:..| :.:..|:||.|::..:..:.|:.::. :|:||:|:||
 Frog    81 DYSLGSHLPNLRQLKLNNSILTSVRDLGTSLSQLQVLWLAQCGLTDLDGIASLC-SLKELYLAYN 144

  Fly   104 LIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPL-----SEGLDEP--TW 161
            .:..:..|:.|:.|:||.:..|.::...|...||...:|..|.:.|||:     .|..:.|  .:
 Frog   145 DLTDLSELSMLENLEVLDLEGNNLEQIKELQYLALCSNLTTLTLEGNPICTRPSPEAAESPDYNY 209

  Fly   162 RAECIKRLPTIRKLDGEPV 180
            ||:....:|.:|.||..||
 Frog   210 RADVRSLIPHLRNLDDAPV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 38/147 (26%)
leucine-rich repeat 50..71 CDD:275380 1/21 (5%)
leucine-rich repeat 95..116 CDD:275380 8/20 (40%)
leucine-rich repeat 117..141 CDD:275380 7/23 (30%)
lrrc56XP_012817843.1 LRR_4 89..132 CDD:289563 6/42 (14%)
leucine-rich repeat 91..113 CDD:275380 1/21 (5%)
LRR_4 113..153 CDD:289563 11/40 (28%)
leucine-rich repeat 114..135 CDD:275380 5/21 (24%)
LRR_4 134..175 CDD:289563 13/41 (32%)
LRR_8 135..193 CDD:290566 19/57 (33%)
leucine-rich repeat 136..157 CDD:275380 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.