DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and drc3

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001123832.1 Gene:drc3 / 100170587 XenbaseID:XB-GENE-1003585 Length:522 Species:Xenopus tropicalis


Alignment Length:158 Identity:51/158 - (32%)
Similarity:79/158 - (50%) Gaps:7/158 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAV 91
            |..|:..:..|.|:|: |.......::.:..|:||||.||..:..|..|.||.|.|:.|.||:|:
 Frog    45 VSSLRLDFKNILKIDN-LWQFHSLTKLQLDNNIIEKISGLDTLVHLVWLDLSFNNIEVIEGLKAL 108

  Fly    92 AETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGL 156
            .: ||:|.|..|.|..::.:..|..|:||.:.||.:........|.:.:.|..|.:.||||||  
 Frog   109 TK-LEDLSLYNNRISVVENMDTLSNLQVLSLGNNNLTSLENLIYLRKFKQLRTLSLAGNPLSE-- 170

  Fly   157 DEPTWRAECIKRLPTIRKLDGEPVVLNE 184
             :..::......||.:..||..  :|||
 Frog   171 -DDQYKLFIAAHLPNLAYLDFR--LLNE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 46/142 (32%)
leucine-rich repeat 50..71 CDD:275380 7/20 (35%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 6/23 (26%)
drc3NP_001123832.1 leucine-rich repeat 47..66 CDD:275380 5/19 (26%)
LRR_RI <60..211 CDD:238064 46/143 (32%)
leucine-rich repeat 67..88 CDD:275378 7/20 (35%)
LRR_8 88..143 CDD:290566 22/55 (40%)
leucine-rich repeat 89..110 CDD:275378 10/20 (50%)
LRR_4 109..149 CDD:289563 12/40 (30%)
leucine-rich repeat 111..132 CDD:275378 7/20 (35%)
leucine-rich repeat 133..157 CDD:275378 6/23 (26%)
leucine-rich repeat 158..169 CDD:275378 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.