| Sequence 1: | NP_610483.1 | Gene: | ODA-Dnal1 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_012820868.2 | Gene: | sycp2l / 100101666 | XenbaseID: | XB-GENE-919974 | Length: | 997 | Species: | Xenopus tropicalis |
| Alignment Length: | 46 | Identity: | 13/46 - (28%) |
|---|---|---|---|
| Similarity: | 17/46 - (36%) | Gaps: | 9/46 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 93 ETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAE 138 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ODA-Dnal1 | NP_610483.1 | PPP1R42 | 37..180 | CDD:455733 | 13/46 (28%) |
| leucine-rich repeat | 50..71 | CDD:275380 | |||
| leucine-rich repeat | 95..116 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 117..141 | CDD:275380 | 6/22 (27%) | ||
| sycp2l | XP_012820868.2 | SYCP2_ARLD | 36..207 | CDD:465809 | |
| SYCP2_SLD | 299..408 | CDD:465811 | 13/46 (28%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||