DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or19a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:417 Identity:82/417 - (19%)
Similarity:145/417 - (34%) Gaps:99/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RALEIVGFDPSTPQLSLKHPIW-----AGILILSLISH--NWPMVVYALQDLSDLTRLTDNFAVF 68
            |...|:|..|..     |...|     |..::.::..|  .|......|...:.|....::..|.
  Fly    17 RIFRIMGIHPPG-----KRTFWGRHYTAYSMVWNVTFHICIWVSFSVNLLQSNSLETFCESLCVT 76

  Fly    69 MQGSQSTFKFLVMMAKRRRIGSLI--HRLHKLNQAASATPNHLEK--------------IERENQ 117
            |   ..|...|.::..||..|.:|  |.|.:|          |:|              |||...
  Fly    77 M---PHTLYMLKLINVRRMRGQMISSHWLLRL----------LDKRLGCDDERQIIMAGIERAEF 128

  Fly   118 LDRYVARSFRNAAYGVICASAIAPMLLGLWGYVETGVFTPTTPMEFNFWLDERKPHFYWPIYV-W 181
            :       ||....|:.|.     ::||:. |:..                ..:|...:|.:: |
  Fly   129 I-------FRTIFRGLACT-----VVLGII-YISA----------------SSEPTLMYPTWIPW 164

  Fly   182 GVLGVAAAAWLA---------IATDTLFSWL-----THNVVIQFQLLELVLEEKDLNGG------ 226
            .... :.:|:||         :|..||...|     |:.:::......|.|....|..|      
  Fly   165 NWRD-STSAYLATAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAV 228

  Fly   227 --DSRLTGFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFSRSGWSAQVPFRATFL 289
              .:.|.|::..|:|.|.|.|.|........|:::..:....|.:.: |...|....:.|.....
  Fly   229 RMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICY-FLLFGNVGIMRFMNMLF 292

  Fly   290 VAIIIQLSS--YCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRP-AKIFGFM 351
            :.:|:...:  .||..|...::..::..||| ..||...:...|||..:::.|.|.| ..:.|.:
  Fly   293 LLVILTTETLLLCYTAELPCKEGESLLTAVY-SCNWLSQSVNFRRLLLLMLARCQIPMILVSGVI 356

  Fly   352 FVVDLPLLLWVIRTAGSFLAMLRTFER 378
            ..:.:.....:|:.|.:.|.:|....:
  Fly   357 VPISMKTFTVMIKGAYTMLTLLNEIRK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 68/344 (20%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 69/351 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.