DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or98a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:232 Identity:46/232 - (19%)
Similarity:87/232 - (37%) Gaps:32/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 WPIY------------VWGVLGVAAAAWLAIATDTLFS---WLTHNVV--IQFQLLELVLEEKDL 223
            |.||            .|.......|..|...|.||.|   .|.:.::  :..:||.|.:|....
  Fly   165 WRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCT 229

  Fly   224 NGGDS------RLTGFVSRHRIALDLAKELSSIFGEIVFVKYML--SYLQLCMLAFRFSRSGWSA 280
            :.|.|      .|...:..|.:.:|.|..:.......:||:::|  ..|.|.|:...|....|:.
  Fly   230 DSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIWTG 294

  Fly   281 QVPFRATFLVAIIIQLSSYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRP- 344
            ..  ...::..:::|...:|:..:.:|:....:..|:: ..||...:...:...:..:..||:. 
  Fly   295 LA--TVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIF-HSNWINSSRSYKSSLRYFLKNAQKSI 356

  Fly   345 AKIFGFMFVVDLPLLLWVIRTAGS---FLAMLRTFER 378
            |...|.:|.:.....:.|.:.|.|   |:..|...:|
  Fly   357 AFTAGSIFPISTGSNIKVAKLAFSVVTFVNQLNIADR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 41/216 (19%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 41/216 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.