DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or85c

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524280.2 Gene:Or85c / 41008 FlyBaseID:FBgn0037591 Length:389 Species:Drosophila melanogaster


Alignment Length:402 Identity:90/402 - (22%)
Similarity:161/402 - (40%) Gaps:72/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VGFDPST-PQLSLKHPIWAGILILSLISHNWPMVVYALQDLSDLTRLTDNFAVFMQGSQSTFKFL 79
            ||.:|.| ...|.|..:|:.:|.       |..|:       :|:.:.....:::..:.|..||:
  Fly    14 VGIEPYTIDSRSKKASLWSHLLF-------WANVI-------NLSVIVFGEILYLGVAYSDGKFI 64

  Fly    80 VMMAKRRRIGSLIHRLHKL------NQAASATPNHLEKI-------ERENQLDRYVARSFR-NAA 130
            ..:.....||.:|..:.|:      ....|.....||.|       |...:||||:....| :..
  Fly    65 DAVTVLSYIGFVIVGMSKMFFIWWKKTDLSDLVKELEHIYPNGKAEEEMYRLDRYLRSCSRISIT 129

  Fly   131 YGVICASAIAPMLLGLWGY--------------VETGVFTPTTPMEFNF---WLDERKPHFYWPI 178
            |.::.:..|       |.:              ::..|...|.|....|   |      |..|..
  Fly   130 YALLYSVLI-------WTFNLFSIMQFLVYEKLLKIRVVGQTLPYLMYFPWNW------HENWTY 181

  Fly   179 YV----WGVLGVAAAAWLAIATDTLFSWLTHNVVIQFQLLELVLEEKDLNGGDSRLTGFVSR--- 236
            ||    ....|..:|:. .|:||.|...:...||:.|..|..|:|::.|:...|..:.|:::   
  Fly   182 YVLLFCQNFAGHTSASG-QISTDLLLCAVATQVVMHFDYLARVVEKQVLDRDWSENSRFLAKTVQ 245

  Fly   237 -HRIALDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFSRSGWSAQVPFRA-TFLVAIIIQLSSY 299
             |:..|.|...|:.|||..:.:.:|:|...:|.:.|:.: .|....:..:. .||.:.:.|:...
  Fly   246 YHQRILRLMDVLNDIFGIPLLLNFMVSTFVICFVGFQMT-VGVPPDIMIKLFLFLFSSLSQVYLI 309

  Fly   300 CYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIFGFMFV-VDLPLLLWVI 363
            |:.|:.|...|.:::.:.|.| ||.....:.||.....|.|.||...:...:|: :....:..::
  Fly   310 CHYGQLIADASSSLSISAYKQ-NWQNADIRYRRALVFFIARPQRTTYLKATIFMNITRATMTDLL 373

  Fly   364 RTAGSFLAMLRT 375
            :.:..|.|:|||
  Fly   374 QVSYKFFALLRT 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 74/343 (22%)
Or85cNP_524280.2 7tm_6 63..377 CDD:251636 72/329 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465709
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.