DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or83c

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:402 Identity:79/402 - (19%)
Similarity:155/402 - (38%) Gaps:96/402 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDLSDLTRLT-----DNFAVFMQGSQS 74
            ::|.|..:|:|...:..|.              .::|:.:.:..|..|     .::.|.::.|..
  Fly    24 LLGVDFLSPKLKFNYRTWT--------------TIFAIANYTGFTVFTILNNGGDWRVGLKASLM 74

  Fly    75 T-------FKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERENQLDRY--VARSFRNAA 130
            |       .|||..:.|.:.:..|:.....:........:...:....| :||.  :.:..||..
  Fly    75 TGGLFHGLGKFLTCLLKHQDMRRLVLYSQSIYDEYETRGDSYHRTLNSN-IDRLLGIMKIIRNGY 138

  Fly   131 YGVICASAIAPMLLGLW-GYVETGV--FTPTTPMEFNFWLDERKPHFYWPIY--------VWGVL 184
            ....|...:.|:.:.:: |...|.:  ..|..|:|.|:        .|...|        |.||.
  Fly   139 VFAFCLMELLPLAMLMYDGTRVTAMQYLIPGLPLENNY--------CYVVTYMIQTVTMLVQGVG 195

  Fly   185 GVAAAAWLAIATDTLFSWLTHNVVIQFQLLEL--VLEEK-----------DLNGGDSR---LTGF 233
            ..:...::.:.   |...||...::|.::.||  .||:|           .::|.::|   |...
  Fly   196 FYSGDLFVFLG---LTQILTFADMLQVKVKELNDALEQKAEYRALVRVGASIDGAENRQRLLLDV 257

  Fly   234 VSRHRIALDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFSRSGWSAQVPFRATFLVAIIIQLSS 298
            :..|::..|..:.:::::.|::..: :||.....||:|..:.|  |..:| .|.|.|.....:|.
  Fly   258 IRWHQLFTDYCRAINALYYELIATQ-VLSMALAMMLSFCINLS--SFHMP-SAIFFVVSAYSMSI 318

  Fly   299 YCYGGEYIKQQSLAIAQAVYGQ-------INWPEMTPKKRRLWQMVIMRAQRP--AKIFGFMFVV 354
            ||..|        .|.:..|.|       :.|.|::.::|:|:..::..:|.|  .:|.|.|.: 
  Fly   319 YCILG--------TILEFAYDQVYESICNVTWYELSGEQRKLFGFLLRESQYPHNIQILGVMSL- 374

  Fly   355 DLPLLLWVIRTA 366
                   .:|||
  Fly   375 -------SVRTA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 71/348 (20%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 70/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.