DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Orco

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:389 Identity:67/389 - (17%)
Similarity:136/389 - (34%) Gaps:128/389 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VMMAKRRRIGSLIHRLHKLNQAASATP---------------NHLEKIERENQLDRYVARSFR-- 127
            :.:||.|::..|:    .|...||||.               :|........::.|...:||.  
  Fly   127 IALAKMRKLFFLV----MLTTVASATAWTTITFFGDSVKMVVDHETNSSIPVEIPRLPIKSFYPW 187

  Fly   128 NAAYGV---------------------ICASAIAPMLLGLWGYVE--TGVFTPTTPMEFNFWLDE 169
            ||::|:                     :|.......|:.....::  .|:..|.  ||.:..||.
  Fly   188 NASHGMFYMISFAFQIYYVLFSMIHSNLCDVMFCSWLIFACEQLQHLKGIMKPL--MELSASLDT 250

  Fly   170 RKPHFYWPIYVWGVLGVAAAAWLAIATDTLFSWLTHNVVIQFQLLELVLEEKD------------ 222
            .:|:             :||.:.:::.::. |.|.||            ||||            
  Fly   251 YRPN-------------SAALFRSLSANSK-SELIHN------------EEKDPGTDMDMSGIYS 289

  Fly   223 ----------------------------LNGGD-------------SRLTGFVSRHRIALDLAKE 246
                                        :||.:             |.:..:|.||:..:.|...
  Fly   290 SKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAA 354

  Fly   247 LSSIFGEIVFVKYMLSYLQLCMLAFRFSR-SGWSAQVPFRATFLVAIIIQLSSYCYGGEYIKQQS 310
            :...:|..:.:..:.|.::|.:||::.:: :|.:........:|...:.|:..:|..|..:.::|
  Fly   355 IGDTYGAALLLHMLTSTIKLTLLAYQATKINGVNVYAFTVVGYLGYALAQVFHFCIFGNRLIEES 419

  Fly   311 LAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIFGF-MFVVDLPLLLWVIRTAGSFLAML 373
            .::.:|.| ..:|.:.:.:.:...|:|..:.|:...|.|. .|.|.|.|...|:....::..:|
  Fly   420 SSVMEAAY-SCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVL 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 66/381 (17%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 65/377 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.