DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or71a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:380 Identity:81/380 - (21%)
Similarity:149/380 - (39%) Gaps:65/380 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SLKHPIWAGILILSLISHNWPMVVYALQDLSDLTRLTDNF-------AVFMQGSQSTFKFLVMMA 83
            |:..|.|.          ||.  .|||.     ...|..|       |:..:..|.|...|::..
  Fly    27 SVSTPDWT----------NWQ--AYALH-----VPFTFLFVLLLWLEAIKSRDIQHTADVLLICL 74

  Fly    84 KRRRIGSLIHRLHKLNQAASATPNH-----LEKIERENQLD--RYVARSF-RNAAYGVICASAIA 140
            ....:|..:..:.|....|....:.     |.::..:.::|  |:..|.| |...:..:|::.:.
  Fly    75 TTTALGGKVINIWKYAHVAQGILSEWSTWDLFELRSKQEVDMWRFEHRRFNRVFMFYCLCSAGVI 139

  Fly   141 PMLLGLWGYVETGVFTP--TTPMEFNFWL----DERKPHFYWPIYVWGVLGVAAAAWLAIATDTL 199
            |.:          |..|  ..|....||:    |.::|..:|..:::....:..|....:..|.:
  Fly   140 PFI----------VIQPLFDIPNRLPFWMWTPFDWQQPVLFWYAFIYQATTIPIACACNVTMDAV 194

  Fly   200 FSWLTHNVVIQFQLL-----ELVLEEKDLNGGDSRLTGFVSRHRIALDLAKELSSIFGEIVFVKY 259
            ..:|..::.:..::|     :|..::|||.   .:....:..|:.....|..:.....:..|.:.
  Fly   195 NWYLMLHLSLCLRMLGQRLSKLQHDDKDLR---EKFLELIHLHQRLKQQALSIEIFISKSTFTQI 256

  Fly   260 MLSYLQLCMLAFRFSRSGWSAQVP-FRA--TFLVAIIIQ-LSSYCYGGEYIKQQSLAIAQAVYGQ 320
            ::|.|.:|...:....|.....:| |.|  .:|||:|:| :....||...|...:: :..::|..
  Fly   257 LVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLPTIYGNAVIDSANM-LTDSMYNS 320

  Fly   321 INWPEMTPKKRRLWQMVIMRAQRPA--KIFGFMFVVDLPLLLWVIRTAGSFLAML 373
             :||:|..:.|||..|.::...||.  |..|| |.:.|||....:..|.|.||:|
  Fly   321 -DWPDMNCRMRRLVLMFMVYLNRPVTLKAGGF-FHIGLPLFTKTMNQAYSLLALL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 67/334 (20%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 63/314 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.