DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or63a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:403 Identity:99/403 - (24%)
Similarity:173/403 - (42%) Gaps:59/403 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VGF---DPSTPQLSLKHPIWAGIL----ILSLISHNWPMVVYALQDLSDLTRLTDNFAVFMQGSQ 73
            |||   |||.....|:  ||..:|    :.||..| |.|:.   :.:.|:.|:.:.....:|...
  Fly    28 VGFNLLDPSRCGQVLR--IWTIVLSVSSLASLYGH-WQMLA---RYIHDIPRIGETAGTALQFLT 86

  Fly    74 STFKFLVMMAKRRRIGSLIH--RLHKLNQAASATPNHLEKIER--------------ENQLDRYV 122
            |..|....:...|:|..|:.  |.|:|.|..       |..||              |:.::||.
  Fly    87 SIAKMWYFLFAHRQIYELLRKARCHELLQKC-------ELFERMSDLPVIKEIRQQVESTMNRYW 144

  Fly   123 ARSFRNA---AYGVICASA---IAPMLLGLWGYV--ETGVFTPTTPMEFNFWLDERK----PHFY 175
            |.:.|..   .|..||.:.   |...::.|:.|.  ..|.:....|:...:...|.|    |:::
  Fly   145 ASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLEFPYYH 209

  Fly   176 WPIYVWGVLGVAAAAWLAIATDTLFSWL-THNVVIQFQLLELVLE-EKDLNGGDSR---LTGFVS 235
            ..:|: ....:......|::.|.:|..| .|:|.:...|.::|.: ..:|...|.|   |...:.
  Fly   210 IQMYL-ETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSELVPPDRRVEYLRCCIY 273

  Fly   236 RHRIALDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFS--RSGWSAQVPFRAT-FLVAIIIQLS 297
            :::...:.|.|:::.|..|.|.:::||.....:..|:.|  ....|:....|.| :|||...|:.
  Fly   274 QYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIV 338

  Fly   298 SYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKI-FGFMFVVDLPLLLW 361
            .|||.|:.....|..||.|.| |:.|...:.:.|.|.:|::||..|..:: ..:...:.||.|:.
  Fly   339 VYCYNGQRFATASEEIANAFY-QVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMA 402

  Fly   362 VIRTAGSFLAMLR 374
            ::||:|.:..:|:
  Fly   403 MVRTSGQYFLLLQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 80/339 (24%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 80/340 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.