DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or59a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:323 Identity:63/323 - (19%)
Similarity:115/323 - (35%) Gaps:104/323 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LEKIERENQLDRYVARSFRNAAYGVICASAIAPMLLGLWGYVETGVFTPTTPM-EFNFWLDERKP 172
            :|::.|  .||..|....:.:.||.:... :..:|     ||..|::.|.... |.:|...|.: 
  Fly    98 MERLLR--LLDERVVGPEQRSIYGQVRVQ-LRNVL-----YVFIGIYMPCALFAELSFLFKEER- 153

  Fly   173 HFYWPIYVWGVLGVAAAAWLAIATDTLFSWL--THN---------VVIQFQLLE---------LV 217
                        |:...||..      |.||  |.|         |.|.||||:         :|
  Fly   154 ------------GLMYPAWFP------FDWLHSTRNYYIANAYQIVGISFQLLQNYVSDCFPAVV 200

  Fly   218 L--------------EEKDLN---GGDSRLTGFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQ 265
            |              ||..|:   ..:..|...::.|:..|:|.:.:.:.....:.:::.::.|.
  Fly   201 LCLISSHIKMLYNRFEEVGLDPARDAEKDLEACITDHKHILELFRRIEAFISLPMLIQFTVTALN 265

  Fly   266 LCMLAFRFSRSGWSAQVPF------RATFL---VAIIIQLSSYCYGG---EYIKQQSLAIAQAVY 318
            :|:        |.:|.|.|      |..|:   :|:.:|:...|:.|   ||           .:
  Fly   266 VCI--------GLAALVFFVSEPMARMYFIFYSLAMPLQIFPSCFFGTDNEY-----------WF 311

  Fly   319 GQI-------NWPEMTPK-KRRLWQMVIMRAQRPAKIFGFMFVVDLPLLLWVIRTAGSFLAML 373
            |::       ||...... ||::...|....::...:.|.|..:.|......::.|.|...::
  Fly   312 GRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTII 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 61/315 (19%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 61/315 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.