DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or49b

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:369 Identity:76/369 - (20%)
Similarity:149/369 - (40%) Gaps:72/369 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HNWPMVVYALQDLSDLTRLTDNFAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHK-------LNQ 100
            |.:..:||.:.....||.:..|..:.:....:..:..:::|...|..:||.:|.:       ||.
  Fly    38 HIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLLADHDRYLALIQKLTEAYYDLLNLND 102

  Fly   101 AASATPNHLEKIERENQLDRYVARSFRNAAYGVICASAIAPMLLGLWGYVETGVFTP---TTPME 162
            :..:     |.:::.|::.:.:||.  |..:|::.:     |..||:....:....|   ..|  
  Fly   103 SYIS-----EILDQVNKVGKLMARG--NLFFGMLTS-----MGFGLYPLSSSERVLPFGSKIP-- 153

  Fly   163 FNFWLDERKPHFYWPIYVWGVLGVAAAAWLAIATDTLFSWLTHNVVIQFQLLELVLEEKDLNG-- 225
               .|:|.:..:|...|::.:|.......:.|...:|...|....:::.:.|:..|.:..|..  
  Fly   154 ---GLNEYESPYYEMWYIFQMLITPMGCCMYIPYTSLIVGLIMFGIVRCKALQHRLRQVALKHPY 215

  Fly   226 GDSRLTGFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQ-----------------------LC 267
            ||          |...:|.:|:      |..::|..|.::                       ||
  Fly   216 GD----------RDPRELREEI------IACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLC 264

  Fly   268 MLAFRFSRSGWSAQVPFRATFLVAIIIQ-LSSYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKR 331
            .|.|.......::|:.....::..|:.| |:.|.|..| :::|:||:|.|.| :..|.......|
  Fly   265 ALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANE-LREQNLAVATAAY-ETEWFTFDVPLR 327

  Fly   332 RLWQMVIMRAQRPAKI-FGFMFVVDLPLLLWVIRTAGSFLAMLR 374
            :....::|||||||.| .|.:..:.|.|...::.|..:|..:|:
  Fly   328 KNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 69/339 (20%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 71/345 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.