DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or45b

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:421 Identity:99/421 - (23%)
Similarity:162/421 - (38%) Gaps:94/421 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FAVQRRALEIVGFDPSTPQLSLKHPIWAGILILSLI--------------SHNWPMVVYALQDLS 56
            |.|.|.:..::|......| |..|.:|   |:.:.:              ||.....|.|:    
  Fly    17 FFVTRYSFGLLGLRFGKEQ-SWLHLLW---LVFNFVNLAHCCQAEFVFGWSHLRTSPVDAM---- 73

  Fly    57 DLTRLTDNFAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERENQLDRY 121
                  |.|........:.||...|..:|:.:..|:.|:..|..         |:.:||:...:.
  Fly    74 ------DAFCPLACSFTTLFKLGWMWWRRQEVADLMDRIRLLIG---------EQEKREDSRRKV 123

  Fly   122 VARSFRNAAYGVI--CASAIAPMLLGLWGYVETGVFTPTT--------PMEFNFWLD-------- 168
            ..||:    |.::  |.     ||:...|.:.||.|...:        ..||.|.:.        
  Fly   124 AQRSY----YLMVTRCG-----MLVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDF 179

  Fly   169 -ERKPHFYWPI-YVWGVLGVAAAAWLAIATDTLFSWLTHNVVIQFQLLELVLEE-----KDLNGG 226
             .|.|.|  |: |::.........:....||..|...|..:....|.|...:::     :|.:..
  Fly   180 AHRMPWF--PVFYLYSTWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLR 242

  Fly   227 DS-----RLTGFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQLC-----MLAFRFSRSGWSAQ 281
            :|     ||...|.||.....:.||.|.|.....||.::.:.|.:.     :|.:    ||::..
  Fly   243 ESKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLY----SGYNII 303

  Fly   282 VPFRATFLVAIIIQLSSYCYGGEYIKQQSLAIAQAVYGQ--INWPEMTPKKRRLWQMVIMRAQRP 344
            .....||.|:..|.|  |||||..:..:||::.:|.|..  ..|...|  :||:: ::|:|||||
  Fly   304 RYVVYTFTVSSAIFL--YCYGGTEMSTESLSLGEAAYSSAWYTWDRET--RRRVF-LIILRAQRP 363

  Fly   345 AKIFGFMFVVDLPLLLWVIRTAGSFLAMLRT 375
            ..:....|...||:...||:..||.:|:.:|
  Fly   364 ITVRVPFFAPSLPVFTSVIKFTGSIVALAKT 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 81/339 (24%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 84/356 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.