DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or42b

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:413 Identity:83/413 - (20%)
Similarity:157/413 - (38%) Gaps:99/413 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RALEIVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDL-SDLTRLTD----NFAVFMQ 70
            ||::.:|:.|  |:..:...::   |..:|::..|......|..| |.:|::..    .|...:|
  Fly    26 RAMKFIGWLP--PKQGVLRYVY---LTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSLQ 85

  Fly    71 ------GSQ----STFKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERENQLDRYVARS 125
                  ||.    .|:..|..:.|.:.|      |.:|:...:|       :|...::...||||
  Fly    86 VCINAYGSSVKVAITYSMLWRLIKAKNI------LDQLDLRCTA-------MEEREKIHLVVARS 137

  Fly   126 FRNAAY----GVICASAIAPMLLGLWGYVETGVFTPTTPMEFNFWLDERKP-HFYWPIYVW--GV 183
              |.|:    .|.|..|.:..|..:                    |..|.| ..|.|...|  |.
  Fly   138 --NHAFLIFTFVYCGYAGSTYLSSV--------------------LSGRPPWQLYNPFIDWHDGT 180

  Fly   184 LGVAAAAWLAIATDTLFSWLTHNVVIQFQL---------------LELVLE-------EKDLNGG 226
            |.:    |:|   .||...:....|:|.||               |:::.|       :::|:..
  Fly   181 LKL----WVA---STLEYMVMSGAVLQDQLSDSYPLIYTLILRAHLDMLRERIRRLRSDENLSEA 238

  Fly   227 DS--RLTGFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQL--CMLAFRFSRSGWSAQVPFRAT 287
            :|  .|...|..|::.|.....:..:....:|.:::|..|.|  .::...|....|:....|  .
  Fly   239 ESYEELVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASF--M 301

  Fly   288 FLVAIIIQLSSYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRP-AKIFGFM 351
            |::.|::|...:||....|.:...::..|:: |.||.:.:.:.:......:...|:| ..|.|.:
  Fly   302 FVITILLQTFPFCYTCNLIMEDCESLTHAIF-QSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGI 365

  Fly   352 FVVDLPLLLWVIRTAGSFLAMLR 374
            |.:.:...:.|.:.|.|.:.:.:
  Fly   366 FQISMSSNISVAKFAFSVITITK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 69/346 (20%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 69/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.