DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or35a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:431 Identity:81/431 - (18%)
Similarity:151/431 - (35%) Gaps:141/431 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WPMVVYALQDL--------SDLTRLTDNF------AVFMQGSQSTFKFLVMMAKRRRIGS----- 90
            ||:.|:.|..:        ....|..|..      .||||.:.:..::|...|..|.:.:     
  Fly    18 WPLAVFRLNHIFWPLDPSTGKWGRYLDKVLAVAMSLVFMQHNDAELRYLRFEASNRNLDAFLTGM 82

  Fly    91 ----------------LIH--RLHKLNQAASAT--------PNHLEKIERENQLDRYVARSFRNA 129
                            |:|  :|.|..:...|.        |....|::.:..::|.|     :|
  Fly    83 PTYLILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFRKVDGKMIINRLV-----SA 142

  Fly   130 AYG-VICASAIAPMLLGLWGYVETGVFTPTTPMEFNFWLDERKPHFYWPIYVWGVLGVAAAAWLA 193
            .|| ||....||| :..:....:..:::...|.:.:            |:|::..| :....|:.
  Fly   143 MYGAVISLYLIAP-VFSIINQSKDFLYSMIFPFDSD------------PLYIFVPL-LLTNVWVG 193

  Fly   194 IATDTLFSWLTHNVVIQFQLLELVLEEKDLNGG------DSRLTGFVSRHRIALD---LAKELSS 249
            |..||:....|:      .|.||::.   |||.      |.:|.  :.:..:|.|   :||:|..
  Fly   194 IVIDTMMFGETN------LLCELIVH---LNGSYMLLKRDLQLA--IEKILVARDRPHMAKQLKV 247

  Fly   250 I-------------FGE--------IVFVKYMLSYLQLCMLAFRFSRSGWSAQVPFRATFLVAII 293
            :             ||:        .||:.:..:...||.|:|:       |.....|.::.|| 
  Fly   248 LITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFK-------AYTNPMANYIYAI- 304

  Fly   294 IQLSSYCYGGEYIKQQSLA-----------IAQAVYGQINWPEM-----TPKKR----RLWQMVI 338
                  .:|.:.::..||.           ....:|...:|.::     .|.:.    :|..:.|
  Fly   305 ------WFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLLKLINLAI 363

  Fly   339 MRAQRPAKIFGF-MFVVDLPLLLWVIRTAGSFLAMLRTFER 378
            ....:|..:.|. .|.|.|...|.:::.:.|:...|.:.:|
  Fly   364 EMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSMQR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 72/391 (18%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 65/362 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.