DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or24a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:420 Identity:79/420 - (18%)
Similarity:151/420 - (35%) Gaps:80/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDASYFAVQRRALEIVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDLS-DLTRLTDN 64
            |:..||.|.:.||.::||.|...:..|. .:|:......|....:....|.:..:. ::....|.
  Fly    12 MERHYFMVPKFALSLIGFYPEQKRTVLV-KLWSFFNFFILTYGCYAEAYYGIHYIPINIATALDA 75

  Fly    65 FAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLNQ----------------------------- 100
            .........|..|.:.:...:..:.|||.|:..|.:                             
  Fly    76 LCPVASSILSLVKMVAIWWYQDELRSLIERVRFLTEQQKSKRKLGYKKRFYTLATQLTFLLLCCG 140

  Fly   101 ---AASATPNHLEKIERENQLDRYVARSF-RNAAYGVICASAIAPMLLGLWGYVETGVFTPTTPM 161
               :.|.:..||        :|..:.|:. ::..|..........:||.|          |..|:
  Fly   141 FCTSTSYSVRHL--------IDNILRRTHGKDWIYETPFKMMFPDLLLRL----------PLYPI 187

  Fly   162 EFNFWLDERKPHFYWPIYVWGVLGVAAAAW---LAIATDTLFSWLTHNVVIQFQLLELV-LEEKD 222
            .:..        .:|..|:..|..|.|..:   ..:....|...|..:|.   .|||:. :|:..
  Fly   188 TYIL--------VHWHGYITVVCFVGADGFFLGFCLYFTVLLLCLQDDVC---DLLEVENIEKSP 241

  Fly   223 LNGGDSRLT----GFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQL---CMLAFRFSRSGWSA 280
            ....::|:.    ..|.||....:|.:.||.:..||....::.|.|.:   .:....||..|...
  Fly   242 SEAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSGLGIIV 306

  Fly   281 QVPFRATFLVAIIIQLSSYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPA 345
            .|    .:..|:.:::..||.||.:|.:....:|::.:.. :|...:.:.:::..:::.||||..
  Fly   307 YV----VYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSS-HWYGHSVRVQKMTLLMVARAQRVL 366

  Fly   346 KIFGFMFVVDLPLLLWVIRTAGSFLAMLRT 375
            .|....|...|..|..::|..||.:|:.::
  Fly   367 TIKIPFFSPSLETLTSILRFTGSLIALAKS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 62/346 (18%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 63/353 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.