DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or22b

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:412 Identity:81/412 - (19%)
Similarity:142/412 - (34%) Gaps:115/412 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDLSDLTRLTDNFAVFMQGS------------ 72
            |...:..|.:.:|:..:.|         :::.|..:|........|..|..|.            
  Fly    39 PENKRWDLHYKLWSTFVTL---------LIFILLPISVSVEYIQRFKTFSAGEFLSSIQIGVNMY 94

  Fly    73 QSTFK-FLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEK----IERENQLDRYVARS-----FR 127
            .|:|| :|.||..::|            |.|..:.:.|:|    .|....:.|:||..     |.
  Fly    95 GSSFKSYLTMMGYKKR------------QEAKMSLDELDKRCVCDEERTIVHRHVALGNFCYIFY 147

  Fly   128 NAAYGVICASAIAPMLLGLWGYVETGVFTPTTPMEFNFWLDERKPHFYWP-------IYVWGVLG 185
            :.||.....|.....::                ...:.|      ..|:|       .|:..:..
  Fly   148 HIAYTSFLISNFLSFIM----------------KRIHAW------RMYFPYVDPEKQFYISSIAE 190

  Fly   186 VAAAAW---LAIATDT--LFSWLTHNVVIQFQLLELVLEEKDLNGGDSR--------LTGFVSRH 237
            |....|   :.:.||.  |.|.    |:.:..:..|....::|.....|        |...|..|
  Fly   191 VILRGWAVFMDLCTDVCPLISM----VIARCHITLLKQRLRNLRSEPGRTEDEYLKELADCVRDH 251

  Fly   238 RIALDLAKELSSIFGEIVFVKYML--SYLQLCMLAFRFSRSGWSAQVPFRATFLVAIIIQLSSYC 300
            |:.||....|.|:|...:||:::|  ..|.|.|:...|. |..|..|.. ..|:..:.:|...:|
  Fly   252 RLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFF-STLSTGVAV-VLFMSCVSMQTFPFC 314

  Fly   301 YGGEYIKQQSLAIAQAVYGQINWPEMTPKKRR-----------LWQMVIMRAQRPAKIFGFMFVV 354
            |....|......:|.::: |.:|   |...||           |.|.:|:.|       |.:|.:
  Fly   315 YLCNMIMDDCQEMADSLF-QSDW---TSADRRYKSTLVYFLHNLQQPIILTA-------GGVFPI 368

  Fly   355 DLPLLLWVIRTAGSFLAMLRTF 376
            .:...|.:::.|.:.:.:::.|
  Fly   369 SMQTNLNMVKLAFTVVTIVKQF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 73/357 (20%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 71/350 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.