DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or65a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:247 Identity:53/247 - (21%)
Similarity:108/247 - (43%) Gaps:41/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 TTPMEFNFWLDERKPHFY--WPI-----------YVWGVLGVAAAA-------WLAIATD---TL 199
            :||    ||::.:...|:  ||.           |:  ::.|:.:.       ||.:..:   :|
  Fly   176 STP----FWIESQTLPFHVSWPFQLHDPSKHPIAYI--IIFVSQSTTMLYFLIWLGVVENMGVSL 234

  Fly   200 FSWLT---HNVVIQFQ-LLELVLEEKDLNGGD-SRLTGFVSRHRIALDLAKELSSIFGEIVFVKY 259
            |..||   ..:.|:.: |.||.|.::|:...: .|:|.|   |:..:.|....:.||.....::.
  Fly   235 FFELTSALRVLCIELRNLQELCLGDEDMLYRELCRMTKF---HQQIILLTDRCNHIFNGAFIMQM 296

  Fly   260 MLSYLQLCMLAFRFSRSGWSAQVPFRATFLVAIII-QLSSYCYGGEYIKQQSLAIAQAVYGQINW 323
            ::::|.:.:..|....:..:.||......::.:.: .||.:...|:...::|..:|.|||...: 
  Fly   297 LINFLLVSLSLFEVLAAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQVALAVYEAYD- 360

  Fly   324 PEMTPKK-RRLWQMVIMRAQRPAKIFGFMF-VVDLPLLLWVIRTAGSFLAML 373
            |.:..|. .|.:...|.|||:|..:....| ..:|...:::::...|.|.:|
  Fly   361 PNVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 50/239 (21%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 50/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.