DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or2a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:406 Identity:84/406 - (20%)
Similarity:149/406 - (36%) Gaps:82/406 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RALEIVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDLSDLTRL--TDNFAVFMQGSQ 73
            |..|:.|         |..|.....|:..:.|....:||..|..||.|.||  |.|.|...:...
  Fly    20 RVWELTG---------LMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLT 75

  Fly    74 STFKFLVMMAKRRRIGSLIHRLHKLNQAAS---------ATPNHLEKIERENQLDRYVARSFRNA 129
            .|...:|...|...:..:..:||::.....         ..|..:..:.:|..:.:...|:|.:.
  Fly    76 ITITDIVANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFASI 140

  Fly   130 -AYG--VICASAIA----PMLLGLWGYVETGVFTPTTPMEFNFWLDERKPHFYWPIYVWGVLGVA 187
             .:|  :.|...:.    .:|...|..|:              |:...:.  |..|.::.:.|:.
  Fly   141 FVFGTTLSCVRVVVRPDRELLYPAWFGVD--------------WMHSTRN--YVLINIYQLFGLI 189

  Fly   188 AAAWLAIATDT----LFSWLT-HNVVIQFQLLELVLEEKDLNGGDS----RLTGFVSRHRIALDL 243
            ..|....|:|:    ....|| |...::.::..:....:..|.|.:    |...:........||
  Fly   190 VQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDL 254

  Fly   244 AK--ELSSIFGEIVFV----KYMLSYLQLCMLAFRF----SRSGWSAQVPFRATFLVAIIIQLSS 298
            |:  .|..|...::.|    :::.|....|.:|..|    .....:|.: ....|..|:.:::..
  Fly   255 ARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMI-ISIVFFSAVTLEVFV 318

  Fly   299 YCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIFGFMFVVDLPLLLWVI 363
            .||.|:.::.||.|:..|.| ..||.|..||.:|.....:.|.|||:.|:               
  Fly   319 ICYFGDRMRTQSEALCDAFY-DCNWIEQLPKFKRELLFTLARTQRPSLIY--------------- 367

  Fly   364 RTAGSFLAM-LRTFER 378
              ||:::|: |.|||:
  Fly   368 --AGNYIALSLETFEQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 61/337 (18%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 68/351 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.