DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45a and Or69a

DIOPT Version :9

Sequence 1:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:372 Identity:75/372 - (20%)
Similarity:139/372 - (37%) Gaps:76/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RRALEIVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYA----------LQDLSDLTRLTDN 64
            ||:||:      ...|:.:...|.|  .::|:.||...|:|.          :..|::|..:...
  Fly    27 RRSLEV------KRNLAKRIIFWLG--AVNLVYHNIGCVMYGYFGDGRTKDPIAYLAELASVASM 83

  Fly    65 FAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERENQLDRYVARSFRNA 129
            ....:.|:.:.:|   |::.:....:|::...:|.|........:.  ..:.:..|::..:|...
  Fly    84 LGFTIVGTLNLWK---MLSLKTHFENLLNEFEELFQLIKHRAYRIH--HYQEKYTRHIRNTFIFH 143

  Fly   130 AYGVICASAIAPMLLGL---------WGYVETGVFTPTTPMEFNFWLDERKPHFYWPIYVWGVLG 185
            ...|:..::: |:||.:         .||          .::.|.|            |.|.|.|
  Fly   144 TSAVVYYNSL-PILLMIREHFSNSQQLGY----------RIQSNTW------------YPWQVQG 185

  Fly   186 VAAAAWLAIATDTLFSWLTH---NVVIQFQL------LELVLE--EKDLNGGDSR-------LTG 232
            .....:.|:|.. :||..|:   |:.|||.:      ||:..:  .:.|...|:|       |..
  Fly   186 SIPGFFAAVACQ-IFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKY 249

  Fly   233 FVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFSRSGWSAQVPFRATFLVAIIIQLS 297
            .:..|...|:||..::..|.....:...:|.:..|.|||..:...:...:......|:.|....|
  Fly   250 LIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYNFS 314

  Fly   298 SYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRP 344
            ....|...|......:..|.|.  ||.|.....||:..:::|||.:|
  Fly   315 MCRSGTHLILTSGKVLPAAFYN--NWYEGDLVYRRMLLILMMRATKP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 61/308 (20%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 63/317 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.