DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and Tirap

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_001055833.2 Gene:Tirap / 680127 RGDID:1595496 Length:250 Species:Rattus norvegicus


Alignment Length:190 Identity:47/190 - (24%)
Similarity:80/190 - (42%) Gaps:27/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 VCDDIQENLAKDTQRFIMKQEQR-----QTALVEACPP-----PPSDCFETNNNYSSSNNITVGQ 221
            :.|..::.|.|..::..:.||..     |||..:...|     |.|  ..::.:.||:.:.:.|.
  Rat    29 IADWFRQALLKKPKKMPISQESHLSDGSQTATQDGLSPSSGSSPRS--HSSSQSQSSTPSCSSGM 91

  Fly   222 S-----VQILSDEDQRCVQMGQPLPRYNACVLYAEADIDHATEIMNNLESERYNLRLFLRHRDML 281
            |     ..:.|....   ..|:....|:.||.::|.|::.|.|:::.||..:.:||.||:.||..
  Rat    92 SPTSPPTHVDSSSSS---SSGRWSKDYDVCVCHSEEDLEVAQELVSYLEGSKASLRCFLQFRDAA 153

  Fly   282 MGVPFEHVQLSHFMATRCNHLIVVLTEEFLRSPENTY--LVNFTQKIQIENHTRKIIPIL 339
            .|.............:.|.  ::::|..|||.|...|  |...|:....|..|   ||:|
  Rat   154 PGGAIVSELCQALSGSHCR--VLLITPGFLRDPWCKYQMLQALTEAPGSEGCT---IPLL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326 1/4 (25%)
TIR_2 242..375 CDD:304906 30/100 (30%)
TirapXP_001055833.2 TIR_2 117..232 CDD:404550 29/97 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.