DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and SIGIRR

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_005253101.1 Gene:SIGIRR / 59307 HGNCID:30575 Length:504 Species:Homo sapiens


Alignment Length:228 Identity:54/228 - (23%)
Similarity:91/228 - (39%) Gaps:47/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 YNACVLYAEADIDH--ATEIMNNLESERYNLRLFLRHRDML-MGVPFEHVQLSHFMATRCNHLIV 304
            |:|.|.|::...|.  ...|:......|...:|||..||:| ...|...:.::   .:||..|||
Human   165 YDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVN---LSRCRRLIV 226

  Fly   305 VLTEEFLRSP--ENTYLVNFTQKIQIENHTRKIIPILYKTDMHIP-----QTLGIYTHI------ 356
            ||::.||...  .:::.....:.:::   ||:.|.|.::.....|     :.|..:.|:      
Human   227 VLSDAFLSRAWCSHSFREGLCRLLEL---TRRPIFITFEGQRRDPAHPALRLLRQHRHLVTLLLW 288

  Fly   357 KYAGDSKLFNFWDKLARSLHDLDAFSIYSTRQVQTPSPVEESAPRVTTPSIRIQINDKDVTDMPN 421
            :....:...:||.::..:|          .|:||. .|||..      |..::| :|||...:..
Human   289 RPGSVTPSSDFWKEVQLAL----------PRKVQY-RPVEGD------PQTQLQ-DDKDPMLILR 335

  Fly   422 YNSCKVPEAETTIVSV----SGDTGSPLPEHKP 450
               .:|||.......|    .||.|.|...|.|
Human   336 ---GRVPEGRALDSEVDPDPEGDLGMPAQPHSP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326
TIR_2 242..375 CDD:304906 32/147 (22%)
SIGIRRXP_005253101.1 Ig 8..111 CDD:299845
TIR 165..311 CDD:279864 34/161 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.