| Sequence 1: | NP_001260821.1 | Gene: | Myd88 / 35956 | FlyBaseID: | FBgn0033402 | Length: | 537 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017177186.1 | Gene: | Tlr5 / 53791 | MGIID: | 1858171 | Length: | 873 | Species: | Mus musculus |
| Alignment Length: | 403 | Identity: | 75/403 - (18%) |
|---|---|---|---|
| Similarity: | 123/403 - (30%) | Gaps: | 154/403 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 74 GLGHFNETPLSALGIETRTQLSRMLNRKKVLRSEEGYQRDWRGISELAKQKGFVDENANNPMDLV 138
Fly 139 LISWSQRSPQTAKVGHLEHFLGIIDRWDVCDDIQENLAKDTQRF----IMKQEQRQTALVEACPP 199
Fly 200 P-------PSDCFET------NNNYSSSNNITVGQSV----------------QILSDEDQRCVQ 235
Fly 236 MGQPLPRYNACVLYAEADIDH---------------------------------------ATEIM 261
Fly 262 N---NLESERYNLRLFLRHRDMLMGVP-FEHVQLSHFMATRCNHLIVVLTEEFLRSPENTYLVNF 322
Fly 323 TQKIQIENHTRKIIPILYKTDM---------HIPQTLGIYTHIKYAGDSKLFNFWDKLARSLHDL 378
Fly 379 -DAFSIYSTRQVQ 390 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Myd88 | NP_001260821.1 | DD | 90..172 | CDD:301326 | 15/81 (19%) |
| TIR_2 | 242..375 | CDD:304906 | 28/184 (15%) | ||
| Tlr5 | XP_017177186.1 | leucine-rich repeat | 63..93 | CDD:275380 | |
| LRR_8 | <101..146 | CDD:338972 | 5/13 (38%) | ||
| leucine-rich repeat | 112..135 | CDD:275380 | 2/2 (100%) | ||
| leucine-rich repeat | 136..161 | CDD:275380 | 8/40 (20%) | ||
| leucine-rich repeat | 162..186 | CDD:275380 | 7/27 (26%) | ||
| leucine-rich repeat | 187..242 | CDD:275380 | 12/59 (20%) | ||
| leucine-rich repeat | 243..304 | CDD:275380 | 13/66 (20%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 3/26 (12%) | ||
| LRR_8 | 308..363 | CDD:338972 | 5/58 (9%) | ||
| leucine-rich repeat | 329..352 | CDD:275380 | 0/22 (0%) | ||
| LRR_8 | 352..411 | CDD:338972 | 15/79 (19%) | ||
| leucine-rich repeat | 353..376 | CDD:275380 | 7/30 (23%) | ||
| leucine-rich repeat | 377..400 | CDD:275380 | 6/35 (17%) | ||
| PRK15370 | <397..>597 | CDD:185268 | 16/82 (20%) | ||
| leucine-rich repeat | 401..429 | CDD:275380 | 4/27 (15%) | ||
| leucine-rich repeat | 430..464 | CDD:275380 | 9/45 (20%) | ||
| leucine-rich repeat | 465..489 | CDD:275380 | 1/2 (50%) | ||
| leucine-rich repeat | 490..518 | CDD:275380 | |||
| leucine-rich repeat | 519..542 | CDD:275380 | |||
| leucine-rich repeat | 543..561 | CDD:275380 | |||
| leucine-rich repeat | 565..585 | CDD:275380 | |||
| PCC | 569..>647 | CDD:188093 | |||
| TIR | 708..858 | CDD:366714 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||